Rabbit SIRT3 Polyclonal Antibody | anti-SIRT3 antibody

SIRT3 Rabbit pAb

Cat. Num. AAA28346

• Gene Names: SIRT3; SIR2L3
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity purification
• Synonyms: SIRT3; Polyclonal Antibody; SIRT3 Rabbit pAb; SIR2L3; sirtuin 3; anti-SIRT3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: ERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEPLDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDKGKLSLQDVAE

• Applicable Applications for anti-SIRT3 antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:200; IF: 1:50-1:200
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human SIRT3 (NP_036371.1).
• Cellular Location: Mitochondrion matrix
• Positive Samples: 293T, HepG2, Mouse liver, Rat liver
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using SIRT3 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using SIRT3 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using SIRT3 Rabbit pAb at dilution of 1:50 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using SIRT3 Rabbit pAb at dilution of 1:50 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using SIRT3 Rabbit pAb at dilution of 1:50 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts from normal (control) and SIRT3 knockout (KO) 293T cells, using SIRT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of extracts of HepG2 cells, using SIRT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of extracts of Rat liver, using SIRT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse liver, using SIRT3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Related Product Information for anti-SIRT3 antibody

Background: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 63054862
• NCBI GeneID: 23410
• NCBI Accession #: NP_001017524.1
• NCBI GenBank Nucleotide #: NM_001017524.2
• UniProt Accession #: Q9NTG7; Q9Y6E8; B7Z5U6
• Molecular Weight: 43,573 Da
• NCBI Official Full Name: NAD-dependent protein deacetylase sirtuin-3, mitochondrial isoform b
• NCBI Official Synonym Full Names: sirtuin 3
• NCBI Official Symbol: SIRT3
• NCBI Official Synonym Symbols: SIR2L3
• NCBI Protein Information: NAD-dependent protein deacetylase sirtuin-3, mitochondrial; sir2-like 3; sirtuin type 3; SIR2-like protein 3; regulatory protein SIR2 homolog 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; silent mating type information regulation 2, S.cerevisiae,
• UniProt Protein Name: NAD-dependent protein deacetylase sirtuin-3, mitochondrial
• UniProt Gene Name: SIRT3
• UniProt Synonym Gene Names: SIR2L3; hSIRT3
• UniProt Entry Name: SIR3_HUMAN