Rabbit Caspase-3 p17 Polyclonal Antibody | anti-CARTPT antibody

[KO Validated] Caspase-3 p17 Rabbit pAb

Cat. Num. AAA28408

• Gene Names: CARTPT; CART
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
• Purity: Affinity purification
• Synonyms: Caspase-3 p17, Antibody; [KO Validated] Caspase-3 p17 Rabbit pAb; CASP3; CPP32; CPP32B; SCA-1; caspase-3; anti-CARTPT antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
• Sequence: EKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

• Applicable Applications for anti-CARTPT antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:100; IF/ICC: 1:50-1:200; Customer Validation: WB (Homo sapiens)
• Positive Samples: 293T, Jurkat, Mouse lung
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
• Cellular Location: Cytoplasm
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using Caspase-3 p17 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and Caspase-3 p17 knockout (KO) 293T cells, using Caspase-3 p17 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of extracts of Jurkat cells, using Caspase-3 p17 antibody at 1:1000 dilution.Jurkat cells were treated by staurosporine(1 uM) for 3 hour.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse lung, using Caspase-3 p17 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

Related Product Information for anti-CARTPT antibody

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.

Product Categories/Family for anti-CARTPT antibody

Signal Transduction; ErbB-HER Signaling Pathway; Cell Biology & Developmental Biology; Apoptosis; Caspases; Mitochondrial Control of Apoptosis; Inhibition of Apoptosis; Death Receptor Signaling Pathway; Hippo Signaling Pathway; Neuroscience; Neurodegenera

NCBI and Uniprot Product Information

• NCBI GI #: 4757910
• NCBI GeneID: 9607
• NCBI Accession #: NP_004282.1
• NCBI GenBank Nucleotide #: NM_004291.3
• UniProt Accession #: Q16568; Q6FG92
• Molecular Weight: 12,829 Da
• NCBI Official Full Name: cocaine- and amphetamine-regulated transcript protein preproprotein
• NCBI Official Synonym Full Names: CART prepropeptide
• NCBI Official Symbol: CARTPT
• NCBI Official Synonym Symbols: CART
• NCBI Protein Information: cocaine- and amphetamine-regulated transcript protein
• UniProt Protein Name: Cocaine- and amphetamine-regulated transcript protein
• UniProt Gene Name: CARTPT
• UniProt Synonym Gene Names: CART
• UniProt Entry Name: CART_HUMAN