Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Caspase-3 p17 Polyclonal Antibody | anti-CARTPT antibody

[KO Validated] Caspase-3 p17 Rabbit pAb

Gene Names
CARTPT; CART
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
Caspase-3 p17, Antibody; [KO Validated] Caspase-3 p17 Rabbit pAb; CASP3; CPP32; CPP32B; SCA-1; caspase-3; anti-CARTPT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
EKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Applicable Applications for anti-CARTPT antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF/ICC: 1:50-1:200
Customer Validation: WB (Homo sapiens)
Positive Samples
293T, Jurkat, Mouse lung
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using Caspase-3 p17 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse lung using Caspase-3 p17 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse lung using Caspase-3 p17 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and Caspase-3 p17 knockout (KO) 293T cells, using Caspase-3 p17 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and Caspase-3 p17 knockout (KO) 293T cells, using Caspase-3 p17 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of extracts of Jurkat cells, using Caspase-3 p17 antibody at 1:1000 dilution.Jurkat cells were treated by staurosporine(1 uM) for 3 hour.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot) (Western blot analysis of extracts of Jurkat cells, using Caspase-3 p17 antibody at 1:1000 dilution.Jurkat cells were treated by staurosporine(1 uM) for 3 hour.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of extracts of Mouse lung, using Caspase-3 p17 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

WB (Western Blot) (Western blot analysis of extracts of Mouse lung, using Caspase-3 p17 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-CARTPT antibody
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,829 Da
NCBI Official Full Name
cocaine- and amphetamine-regulated transcript protein preproprotein
NCBI Official Synonym Full Names
CART prepropeptide
NCBI Official Symbol
CARTPT
NCBI Official Synonym Symbols
CART
NCBI Protein Information
cocaine- and amphetamine-regulated transcript protein
UniProt Protein Name
Cocaine- and amphetamine-regulated transcript protein
UniProt Gene Name
CARTPT
UniProt Synonym Gene Names
CART
UniProt Entry Name
CART_HUMAN

Similar Products

Product Notes

The CARTPT cartpt (Catalog #AAA28408) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Caspase-3 p17 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Caspase-3 p17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC). WB: 1:500-1:2000 IHC: 1:50-1:100 IF/ICC: 1:50-1:200 Customer Validation: WB (Homo sapiens). Researchers should empirically determine the suitability of the CARTPT cartpt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKELIEALQE VLKKLKSKRV PIYEKKYGQV PMCDAGEQCA VRKGARIGKL CDCPRGTSCN SFLLKCL. It is sometimes possible for the material contained within the vial of "Caspase-3 p17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.