Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114979_SDS_PAGE15.jpg SDS-PAGE

Alanine/arginine aminopeptidase Recombinant Protein | AAP1 recombinant protein

Recombinant Saccharomyces cerevisiae Alanine/arginine aminopeptidase

Average rating 0.0
No ratings yet
Gene Names
AAP1; AAP1'
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alanine/arginine aminopeptidase; N/A; Recombinant Saccharomyces cerevisiae Alanine/arginine aminopeptidase; AAP1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-389aa; Partial
Sequence
MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARIEGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVTGETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDSLRSSHPIEVPVNNADEINQIFDAISYSKG
Sequence Length
389
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114979_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for AAP1 recombinant protein
Positive effector of glycogen accumulation. May be involved in nutrient-sensing.
Product Categories/Family for AAP1 recombinant protein
References
Isolation and characterization of AAP1. A gene encoding an alanine/arginine aminopeptidase in yeast.Caprioglio D.R., Padilla C., Werner-Washburne M.J. Biol. Chem. 268:14310-14315(1993) Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII.Johnston M., Andrews S., Brinkman R., Cooper J., Ding H., Dover J., Du Z., Favello A., Fulton L., Gattung S., Geisel C., Kirsten J., Kucaba T., Hillier L.W., Jier M., Johnston L., Langston Y., Latreille P., Louis E.J., Macri C., Mardis E., Menezes S., Mouser L., Nhan M., Rifkin L., Riles L., St Peter H., Trevaskis E., Vaughan K., Vignati D., Wilcox L., Wohldman P., Waterston R., Wilson R., Vaudin M.Science 265:2077-2082(1994) ) Global analysis of protein expression in yeast.Ghaemmaghami S., Huh W.-K., Bower K., Howson R.W., Belle A., Dephoure N., O'Shea E.K., Weissman J.S.Nature 425:737-741(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60.8 kDa
NCBI Official Full Name
Aap1p
NCBI Official Symbol
AAP1
NCBI Official Synonym Symbols
AAP1'
NCBI Protein Information
Aap1p
UniProt Protein Name
Alanine/arginine aminopeptidase
UniProt Gene Name
AAP1
UniProt Entry Name
AAP1_YEAST

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The AAP1 aap1 (Catalog #AAA114979) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-389aa; Partial. The amino acid sequence is listed below: MSREVLPNNV TPLHYDITLE PNFRAFTFEG SLKIDLQIND HSINSVQINY LEIDFHSARI EGVNAIEVNK NENQQKATLV FPNGTFENLG PSAKLEIIFS GILNDQMAGF YRAKYTDKVT GETKYMATTQ MEATDARRAF PCFDEPNLKA TFAVTLVSES FLTHLSNMDV RNETIKEGKK YTTFNTTPKM STYLVAFIVA DLRYVESNNF RIPVRVYSTP GDEKFGQFAA NLAARTLRFF EDTFNIEYPL PKMDMVAVHE FSAGAMENWG LVTYRVIDLL LDIENSSLDR IQRVAEVIQH ELAHQWFGNL VTMDWWEGLW LNEGFATWMS WYSCNKFQPE WKVWEQYVTD NLQRALNLDS LRSSHPIEVP VNNADEINQI FDAISYSKG. It is sometimes possible for the material contained within the vial of "Alanine/arginine aminopeptidase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.