Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113238_SDS_PAGE15.jpg SDS-PAGE

Acetyl-CoA carboxylase 1 (Acaca) Recombinant Protein | Acaca recombinant protein

Recombinant Rat Acetyl-CoA carboxylase 1 (Acaca), partial

Average rating 0.0
No ratings yet
Gene Names
Acaca; ACC1; Acac
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acetyl-CoA carboxylase 1 (Acaca); N/A; Recombinant Rat Acetyl-CoA carboxylase 1 (Acaca), partial; ACC-alpha; Acaca recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
116-617. Partial,provide Biotin carboxylation domain
Sequence
VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113238_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Acaca recombinant protein
Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.
Product Categories/Family for Acaca recombinant protein
References
"Structure of the coding sequence and primary amino acid sequence of acetyl-coenzyme A carboxylase." Lopez-Casillas F., Bai D.-H., Luo X., Kong I.-S., Hermodson M.A., Kim K.-H. Proc. Natl. Acad. Sci. U.S.A. 85:5784-5788(1988)

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
57.8 kDa
NCBI Official Synonym Full Names
acetyl-CoA carboxylase alpha
NCBI Official Symbol
Acaca
NCBI Official Synonym Symbols
ACC1; Acac
NCBI Protein Information
acetyl-CoA carboxylase 1
UniProt Protein Name
Acetyl-CoA carboxylase 1
UniProt Gene Name
Acaca
UniProt Synonym Gene Names
Acac; ACC1
UniProt Entry Name
ACACA_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Acaca acaca (Catalog #AAA113238) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 116-617. Partial,provide Biotin carboxylation domain. The amino acid sequence is listed below: VIEKVLIANN GIAAVKCMRS IRRWSYEMFR NERAIRFVVM VTPEDLKANA EYIKMADHYV PVPGGANNNN YANVELILDI AKRIPVQAVW AGWGHASENP KLPELLLKNG IAFMGPPSQA MWALGDKIAS SIVAQTAGIP TLPWSGSGLR VDWQENDFSK RILNVPQDLY EKGYVKDVDD GLKAAEEVGY PVMIKASEGG GGKGIRKVNN ADDFPNLFRQ VQAEVPGSPI FVMRLAKQSR HLEVQILADQ YGNAISLFGR DCSVQRRHQK IIEEAPAAIA TPAVFEHMEQ CAVKLAKMVG YVSAGTVEYL YSQDGSFYFL ELNPRLQVEH PCTEMVADVN LPAAQLQIAM GIPLFRIKDI RMMYGVSPWG DAPIDFENSA HVPCPRGHVI AARITSENPD EGFKPSSGTV QELNFRSNKN VWGYFSVAAA GGLHEFADSQ FGHCFSWGEN REEAISNMVV ALKELSIRGD FRTTVEYLIK LLETESFQLN RIDTGWLDRL IA. It is sometimes possible for the material contained within the vial of "Acetyl-CoA carboxylase 1 (Acaca), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.