Acrosomal protein SP-10 Recombinant Protein | ACRV1 recombinant protein
Recombinant Human Acrosomal protein SP-10
Gene Names
ACRV1; SP-10; SPACA2; D11S4365
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acrosomal protein SP-10; N/A; Recombinant Human Acrosomal protein SP-10; Acrosomal vesicle protein 1; ACRV1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-265aa; Full Length
Sequence
QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Sequence Length
265
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Product Categories/Family for ACRV1 recombinant protein
References
Cloning and sequencing of cDNAs coding for the human intra-acrosomal antigen SP-10.Wright R.M., John E., Klotz K., Flickinger C.J., Herr J.C.Biol. Reprod. 42:693-701(1990) ErratumWright R.M., John E., Klotz K., Flickinger C.J., Herr J.C.Biol. Reprod. 43:903-903(1990) Cloning and characterization of the gene coding for the human acrosomal protein SP-10.Wright R.M., Suri A.K., Kornreich B., Flickinger C.J., Herr J.C.Biol. Reprod. 49:316-325(1993) Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Characterization of alternatively spliced human SP-10 mRNAs.Freemerman A.J., Flickinger C.J., Herr J.C.Mol. Reprod. Dev. 41:100-108(1995) Purification and microsequencing of the intra-acrosomal protein SP-10. Evidence that SP-10 heterogeneity results from endoproteolytic processes.Herr J.C., Klotz K., Shannon J., Wright R.M., Flickinger C.J.Biol. Reprod. 47:11-20(1992)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41.8 kDa
NCBI Official Full Name
acrosomal protein SP-10 isoform a
NCBI Official Synonym Full Names
acrosomal vesicle protein 1
NCBI Official Symbol
ACRV1
NCBI Official Synonym Symbols
SP-10; SPACA2; D11S4365
NCBI Protein Information
acrosomal protein SP-10
UniProt Protein Name
Acrosomal protein SP-10
UniProt Gene Name
ACRV1
UniProt Entry Name
ASPX_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ACRV1 acrv1 (Catalog #AAA81662) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-265aa; Full Length. The amino acid sequence is listed below: QPNELSGSID HQTSVQQLPG EFFSLENPSD AEALYETSSG LNTLSEHGSS EHGSSKHTVA EHTSGEHAES EHASGEPAAT EHAEGEHTVG EQPSGEQPSG EHLSGEQPLS ELESGEQPSD EQPSGEHGSG EQPSGEQASG EQPSGEHASG EQASGAPISS TSTGTILNCY TCAYMNDQGK CLRGEGTCIT QNSQQCMLKK IFEGGKLQFM VQGCENMCPS MNLFSHGTRM QIICCRNQSF CNKI. It is sometimes possible for the material contained within the vial of "Acrosomal protein SP-10, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
