Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

LR3 Insulin Like Growth Factor-1 Active Protein

Recombinant Human LR3 Insulin Like Growth Factor-1

Purity
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC
(b) Analysis by SDS-PAGE
Synonyms
LR3 Insulin Like Growth Factor-1; N/A; Recombinant Human LR3 Insulin Like Growth Factor-1; R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, LONG R3IGF1, LONG R3 IGF-1, LONG R3IGF-1.; LR3 Insulin Like Growth Factor-1 active protein
Ordering
Purity/Purification
Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC
(b) Analysis by SDS-PAGE
Form/Format
Lyophilized from a 0.2 um filtered concentrated solution in 20mM PB, pH7.2
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Source
E. coli
Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized LR3 IGF1 in sterile 18M-cm H2O at a concentration of 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
The biological activity is <2ng/mL which was determined by the cell proliferation assay using free human MCF-7 cells and corresponding to a Specific Activity of >5.0 x 105IU/mg
Preparation and Storage
Store desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Related Product Information for LR3 Insulin Like Growth Factor-1 active protein
Recombinant Human LR3 Insulin Like Growth Factor-1 produced in E Coli is a single, non-glycosylated, polypeptide chain containing 83 amino acids and having a molecular mass of 9.1kDa.
Product Categories/Family for LR3 Insulin Like Growth Factor-1 active protein

Similar Products

Product Notes

The LR3 Insulin Like Growth Factor-1 (Catalog #AAA38973) is an Active Protein and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MFPAMPLSSL FVNGPRTLCG AELVDALQFV CGDRGFYFNK PTGYGSSSRR APQTGIV DECCFRSCDL RRLEMYCAPL KPAKSA. It is sometimes possible for the material contained within the vial of "LR3 Insulin Like Growth Factor-1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.