Disintegrin and metalloproteinase domain-containing protein 19 (Adam19) Recombinant Protein | Adam19 recombinant protein
Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 19 (Adam19)
Gene Names
Adam19; Mltnb; AL024287
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Disintegrin and metalloproteinase domain-containing protein 19 (Adam19); N/A; Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 19 (Adam19); Disintegrin and metalloproteinase domain-containing protein 19; ADAM 19; EC=3.4.24.-; Meltrin-beta; Adam19 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
205-920. Full Length of Mature Protein
Sequence
EDLHSMKYVELYLVADYAEFQKNRHDQDATKRKLMEIANYVDKFYRSLNIRIALVGLEVWTHGDKCEVSENPYSTLWSFLSWRRKLLAQKSHDNAQLITGRSFQGTTIGLAPLMAMCSVYQSGGVSMDHSENAIGVASTVAHEIGHNFGMSHDSAHCCSASAADGGCIMAAATGHPFPKVFSWCNRKELDRYLQTGGGMCLSNMPDTRTLYGGRRCGNGYLEDGEECDCGEEEECKNPCCNASNCTLKEGAECAHGSCCHQCKLVAPGTQCREQVRQCDLPEFCTGKSPHCPTNYYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPALDLCFERVNAAGDTYGNCGKGLNGQYRKCSPRDAKCGKIQCQSTQARPLESNAVSIDTTITLNGRRIHCRGTHVYRGPEEEEGEGDMLDPGLVMTGTKCGHNHICFEGQCRNTSFFETEGCGKKCNGHGVCNNNKNCHCFPGWSPPFCNTPGDGGSVDSGPLPPKSVGPVIAGVFSALFVLAVLVLLCHCYRQSHKLGKPSALPFKLRHQFSCPFRVSQSGGTGHANPTFKLQTPQGKRKVTNTPESLRKPSHPPPRPPPDYLRVESPPAPLPAHLNRAAGSSPEAGARIERKESARRPPPSRPMPPAPNCLLSQDFSRPRPPQKALPANPVPGQRTGPRSGGTSLLQPPTSGPQPPRPPAVPVPKLPEYRSQRVGAIISSKI
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100,860 Da
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 19 isoform 1 preproprotein
NCBI Official Synonym Full Names
a disintegrin and metallopeptidase domain 19 (meltrin beta)
NCBI Official Symbol
Adam19
NCBI Official Synonym Symbols
Mltnb; AL024287
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 19; meltrin beta; a disintegrin and metalloproteinase domain 19 (meltrin beta)
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 19
UniProt Gene Name
Adam19
UniProt Synonym Gene Names
Mltnb; ADAM 19
UniProt Entry Name
ADA19_MOUSE
Similar Products
Product Notes
The Adam19 adam19 (Catalog #AAA115984) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 205-920. Full Length of Mature Protein. The amino acid sequence is listed below: EDLHSMKYVE LYLVADYAEF QKNRHDQDAT KRKLMEIANY VDKFYRSLNI RIALVGLEVW THGDKCEVSE NPYSTLWSFL SWRRKLLAQK SHDNAQLITG RSFQGTTIGL APLMAMCSVY QSGGVSMDHS ENAIGVASTV AHEIGHNFGM SHDSAHCCSA SAADGGCIMA AATGHPFPKV FSWCNRKELD RYLQTGGGMC LSNMPDTRTL YGGRRCGNGY LEDGEECDCG EEEECKNPCC NASNCTLKEG AECAHGSCCH QCKLVAPGTQ CREQVRQCDL PEFCTGKSPH CPTNYYQMDG TPCEGGQAYC YNGMCLTYQE QCQQLWGPGA RPALDLCFER VNAAGDTYGN CGKGLNGQYR KCSPRDAKCG KIQCQSTQAR PLESNAVSID TTITLNGRRI HCRGTHVYRG PEEEEGEGDM LDPGLVMTGT KCGHNHICFE GQCRNTSFFE TEGCGKKCNG HGVCNNNKNC HCFPGWSPPF CNTPGDGGSV DSGPLPPKSV GPVIAGVFSA LFVLAVLVLL CHCYRQSHKL GKPSALPFKL RHQFSCPFRV SQSGGTGHAN PTFKLQTPQG KRKVTNTPES LRKPSHPPPR PPPDYLRVES PPAPLPAHLN RAAGSSPEAG ARIERKESAR RPPPSRPMPP APNCLLSQDF SRPRPPQKAL PANPVPGQRT GPRSGGTSLL QPPTSGPQPP RPPAVPVPKL PEYRSQRVGA IISSKI. It is sometimes possible for the material contained within the vial of "Disintegrin and metalloproteinase domain-containing protein 19 (Adam19), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.