Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9) Recombinant Protein | ADAM9 recombinant protein
Recombinant Human Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9), partial
Gene Names
ADAM9; MCMP; MDC9; CORD9; Mltng
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9); N/A; Recombinant Human Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9), partial; ADAM9 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
209-406. Partial,include Peptidase M12B Domain
Sequence
PQTRYVELFIVVDKERYDMMGRNQTAVREEMILLANYLDSMYIMLNIRIVLVGLEIWTNGNLINIVGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGFGGTAGMAFVGTVCSRSHAGGINVFGQITVETFASIVAHELGHNLGMNHDDGRDCSCGAKSCIMNSGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIP
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ADAM9 recombinant protein
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Two alternative splice variants have been identified, encoding distinct isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
72,359 Da
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 9
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 9
NCBI Official Symbol
ADAM9
NCBI Official Synonym Symbols
MCMP; MDC9; CORD9; Mltng
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 9
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 9
UniProt Gene Name
ADAM9
UniProt Synonym Gene Names
KIAA0021; MCMP; MDC9; MLTNG; ADAM 9
Similar Products
Product Notes
The ADAM9 adam9 (Catalog #AAA117690) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 209-406. Partial,include Peptidase M12B Domain. The amino acid sequence is listed below: PQTRYVELFI VVDKERYDMM GRNQTAVREE MILLANYLDS MYIMLNIRIV LVGLEIWTNG NLINIVGGAG DVLGNFVQWR EKFLITRRRH DSAQLVLKKG FGGTAGMAFV GTVCSRSHAG GINVFGQITV ETFASIVAHE LGHNLGMNHD DGRDCSCGAK SCIMNSGASG SRNFSSCSAE DFEKLTLNKG GNCLLNIP. It is sometimes possible for the material contained within the vial of "Disintegrin and metalloproteinase domain-containing protein 9 (ADAM9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.