Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

ADAM DEC1 (Adamdec1) Recombinant Protein | Adamdec1 recombinant protein

Recombinant Mouse ADAM DEC1 (Adamdec1)

Average rating 0.0
No ratings yet
Gene Names
Adamdec1; Dcsn; AI574231; 2210414L24Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADAM DEC1 (Adamdec1); N/A; Recombinant Mouse ADAM DEC1 (Adamdec1); Adamdec1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
209-467. Full Length of Mature Protein
Sequence
NEDLLQGQKYIGLFLVLDNAYYKLYNGNVTQMRTFLFKVLNLLNMIYKTINIQVSLVGMEIWSDQDKIKVEPNLGATFTHFMRWHYSNLGKRIHNHAQLLSGASFRHGRVGMAAGNSFCTTSSVSVIEAKKKNNVALVALMSHELGHALGMKDVPYYTKCPSGSCVMNQYLSSKFPKDFSTVSRSHFQGFLSSRNARCLLLAPDPKNIIKPTCGNQVLDVGEECDCGSPEECTNLCCEPLTCRLKSQPDCSEASNHITE
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Adamdec1 recombinant protein
This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their interactions with germinal center T cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,956 Da
NCBI Official Full Name
ADAM DEC1
NCBI Official Synonym Full Names
ADAM-like, decysin 1
NCBI Official Symbol
Adamdec1
NCBI Official Synonym Symbols
Dcsn; AI574231; 2210414L24Rik
NCBI Protein Information
ADAM DEC1
UniProt Protein Name
ADAM DEC1
UniProt Gene Name
Adamdec1
UniProt Synonym Gene Names
ADAM-like protein decysin-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Adamdec1 adamdec1 (Catalog #AAA116817) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 209-467. Full Length of Mature Protein. The amino acid sequence is listed below: NEDLLQGQKY IGLFLVLDNA YYKLYNGNVT QMRTFLFKVL NLLNMIYKTI NIQVSLVGME IWSDQDKIKV EPNLGATFTH FMRWHYSNLG KRIHNHAQLL SGASFRHGRV GMAAGNSFCT TSSVSVIEAK KKNNVALVAL MSHELGHALG MKDVPYYTKC PSGSCVMNQY LSSKFPKDFS TVSRSHFQGF LSSRNARCLL LAPDPKNIIK PTCGNQVLDV GEECDCGSPE ECTNLCCEPL TCRLKSQPDC SEASNHITE. It is sometimes possible for the material contained within the vial of "ADAM DEC1 (Adamdec1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.