Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114835_SDS_PAGE15.jpg SDS-PAGE

Agouti-related protein Recombinant Protein | AGRP recombinant protein

Recombinant Human Agouti-related protein

Gene Names
AGRP; ART; AGRT; ASIP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Agouti-related protein; N/A; Recombinant Human Agouti-related protein; AGRP recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-132. Full length of the mature protein.
Sequence
AQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114835_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for AGRP recombinant protein
Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.
Product Categories/Family for AGRP recombinant protein
References
Hypothalamic expression of ART, a novel gene related to agouti, is up-regulated in obese and diabetic mutant mice.Shutter J.R., Graham M., Kinsey A.C., Scully S., Luethy R., Stark K.L.Genes Dev. 11:593-602(1997) Antagonism of central melanocortin receptors in vitro and in vivo by agouti-related protein.Ollmann M.M., Wilson B.D., Yang Y.K., Kerns J.A., Chen Y., Gantz I., Barsh G.S.Science 278:135-138(1997) The gene structure and minimal promoter of the human agouti related protein.Brown A.M., Mayfield D.K., Volaufova J., Argyropoulos G.Gene 277:231-238(2001) Association between an agouti-related protein gene polymorphism and anorexia nervosa.Vink T., Hinney A., van Elburg A.A., van Goozen S.H., Sandkuijl L.A., Sinke R.J., Herpertz-Dahlmann B.M., Hebebrand J., Remschmidt H., van Engeland H., Adan R.A.Mol. Psychiatry 6:325-328(2001) SeattleSNPs variation discovery resource Determination of disulfide structure in agouti-related protein (AGRP) by stepwise reduction and alkylation.Bures E.J., Hui J.O., Young Y., Chow D.T., Katta V., Rohde M.F., Zeni L., Rosenfeld R.D., Stark K.L., Haniu M.Biochemistry 37:12172-12177(1998) Characterization of Agouti-related protein binding to melanocortin receptors.Yang Y.K., Thompson D.A., Dickinson C.J., Wilken J., Barsh G.S., Kent S.B., Gantz I.Mol. Endocrinol. 13:148-155(1999) AgRP(83-132) acts as an inverse agonist on the human-melanocortin-4 receptor.Nijenhuis W.A., Oosterom J., Adan R.A.Mol. Endocrinol. 15:164-171(2001) The natural inverse agonist agouti-related protein induces arrestin-mediated endocytosis of melanocortin-3 and -4 receptors.Breit A., Wolff K., Kalwa H., Jarry H., Buch T., Gudermann T.J. Biol. Chem. 281:37447-37456(2006) NMR structure of a minimized human agouti related protein prepared by total chemical synthesis.Bolin K.A., Anderson D.J., Trulson J.A., Thompson D.A., Wilken J., Kent S.B.H., Gantz I., Millhauser G.L.FEBS Lett. 451:125-131(1999) High-resolution NMR structure of the chemically-synthesized melanocortin receptor binding domain AGRP(87-132) of the agouti-related protein.McNulty J.C., Thompson D.A., Bolin K.A., Wilken J., Barsh G.S., Millhauser G.L.Biochemistry 40:15520-15527(2001) Design, pharmacology, and NMR structure of a minimized cystine knot with agouti-related protein activity.Jackson P.J., McNulty J.C., Yang Y.K., Thompson D.A., Chai B., Gantz I., Barsh G.S., Millhauser G.L.Biochemistry 41:7565-7572(2002) A polymorphism in the human agouti-related protein is associated with late-onset obesity.Argyropoulos G., Rankinen T., Neufeld D.R., Rice T., Province M.A., Leon A.S., Skinner J.S., Wilmore J.H., Rao D.C., Bouchard C.J. Clin. Endocrinol. Metab. 87:4198-4202(2002) Functional analysis of the Ala67Thr polymorphism in agouti related protein associated with anorexia nervosa and leanness.de Rijke C.E., Jackson P.J., Garner K.M., van Rozen R.J., Douglas N.R., Kas M.J., Millhauser G.L., Adan R.A.Biochem. Pharmacol. 70:308-316(2005)

NCBI and Uniprot Product Information

NCBI GeneID
181
UniProt Accession #
Molecular Weight
28.5 kDa
NCBI Official Synonym Full Names
agouti related neuropeptide
NCBI Official Symbol
AGRP
NCBI Official Synonym Symbols
ART; AGRT; ASIP2
NCBI Protein Information
agouti-related protein
UniProt Protein Name
Agouti-related protein
UniProt Gene Name
AGRP
UniProt Synonym Gene Names
AGRT; ART
UniProt Entry Name
AGRP_HUMAN

Similar Products

Product Notes

The AGRP agrp (Catalog #AAA114835) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-132. Full length of the mature protein. The amino acid sequence is listed below: AQMGLAPMEG IRRPDQALLP ELPGLGLRAP LKKTTAEQAE EDLLQEAQAL AEVLDLQDRE PRSSRRCVRL HESCLGQQVP CCDPCATCYC RFFNAFCYCR KLGTAMNPCS RT. It is sometimes possible for the material contained within the vial of "Agouti-related protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.