Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA114715_SDS_PAGE15.jpg SDS-PAGE

Allograft inflammatory factor 1 Recombinant Protein | Aif1 recombinant protein

Recombinant Mouse Allograft inflammatory factor 1

Gene Names
Aif1; G1; Iba1; AIF-1; AI607846; D17H6S50E
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Allograft inflammatory factor 1; N/A; Recombinant Mouse Allograft inflammatory factor 1; Ionized calcium-binding adapter molecule 1; Aif1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-147aa; Full Length of Mature Protein
Sequence
SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA114715_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Aif1 recombinant protein
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
References
Allograft inflammatory factor-1 augments productions of interleukin-6, -10, -12 by a mouse macrophage line.Watano K., Iwabuchi K., Fujii S., Ishimori N., Mitsuhashi S., Ato M., Kitabatake A., Onoe K.Immunology 104:307-316(2001) Structure of the mouse iba1 gene.Imai Y., Ohsawa K., Kohsaka S. Allograft inflammatory factor-1 gene.Hu S.P., Russell M.E. Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.Xie T., Rowen L., Aguado B., Ahearn M.E., Madan A., Qin S., Campbell R.D., Hood L.Genome Res. 13:2621-2636(2003) Involvement of Iba1 in membrane ruffling and phagocytosis of macrophages/microglia.Ohsawa K., Imai Y., Kanazawa H., Sasaki Y., Kohsaka S.J. Cell Sci. 113:3073-3084(2000) Iba1 is an actin-cross-linking protein in macrophages/microglia.Sasaki Y., Ohsawa K., Kanazawa H., Kohsaka S., Imai Y.Biochem. Biophys. Res. Commun. 286:292-297(2001) Macrophage/microglia-specific protein Iba1 enhances membrane ruffling and Rac activation via phospholipase C-gamma -dependent pathway.Kanazawa H., Ohsawa K., Sasaki Y., Kohsaka S., Imai Y.J. Biol. Chem. 277:20026-20032(2002) Microglia/macrophage-specific protein Iba1 binds to fimbrin and enhances its actin-bundling activity.Ohsawa K., Imai Y., Sasaki Y., Kohsaka S.J. Neurochem. 88:844-856(2004) X-ray structures of the microglia/macrophage-specific protein Iba1 from human and mouse demonstrate novel molecular conformation change induced by calcium binding.Yamada M., Ohsawa K., Imai Y., Kohsaka S., Kamitori S.J. Mol. Biol. 364:449-457(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.8 kDa
NCBI Official Full Name
allograft inflammatory factor 1
NCBI Official Synonym Full Names
allograft inflammatory factor 1
NCBI Official Symbol
Aif1
NCBI Official Synonym Symbols
G1; Iba1; AIF-1; AI607846; D17H6S50E
NCBI Protein Information
allograft inflammatory factor 1
UniProt Protein Name
Allograft inflammatory factor 1
UniProt Gene Name
Aif1
UniProt Synonym Gene Names
Iba1; AIF-1
UniProt Entry Name
AIF1_MOUSE

Similar Products

Product Notes

The Aif1 aif1 (Catalog #AAA114715) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-147aa; Full Length of Mature Protein. The amino acid sequence is listed below: SQSRDLQGGK AFGLLKAQQE ERLEGINKQF LDDPKYSNDE DLPSKLEAFK VKYMEFDLNG NGDIDIMSLK RMLEKLGVPK THLELKRLIR EVSSGSEETF SYSDFLRMML GKRSAILRMI LMYEEKNKEH KRPTGPPAKK AISELP. It is sometimes possible for the material contained within the vial of "Allograft inflammatory factor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.