Allograft Inflammatory Factor 1 Recombinant Protein | AIF1 recombinant protein
Recombinant Human Allograft Inflammatory Factor 1
Gene Names
AIF1; IBA1; IRT1; AIF-1; IRT-1
Purity
Greater than 90% as determined by SDS PAGE.
Synonyms
Allograft Inflammatory Factor 1; N/A; Recombinant Human Allograft Inflammatory Factor 1; AIF1 Human; Allograft Inflammatory Factor 1 Human Recombinant; AIF-1; Allograft inflammatory factor 1; Em:AF129756.17; G1; IBA1; Ionized calcium-binding adapter molecule 1; IRT-1; Protein G1; AIF1; AIF1 recombinant protein
Host
E Coli
Purity/Purification
Greater than 90% as determined by SDS PAGE.
Form/Format
Filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5.
Filtered White lyophilized (freeze-dried) powder.
Filtered White lyophilized (freeze-dried) powder.
Sequence
MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Sequence Length
147
Solubility
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.
Preparation and Storage
For long term, store lyophilized AIF1 at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C.The lyophilized protein remains stable for 24 months when stored at -20 degree C.
Related Product Information for AIF1 recombinant protein
Description: The AIF1 Human Recombinant contains a total of 155 amino acids having a molecular Mass of 17.7kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His tag.
Introduction: Human AIF1 protein shares 98% homology/identity with that of rat. AIF1 is expressed in macrophages and neutrophils. The expression of AIF1 transcripts is upregulated by IFN-g in rat macrophages. AIF1 is expressed selectively in human macrophage-like cell lines, and in a subset of CD68(+) macrophages in the interstitial and perivascular spaces of human heart allografts. In quiescent cultured human vascular smooth muscle cells synthesis of AIF1 is induced by IFN-g, IL1b, and conditioned medium of T-cells. Overexpression of AIF1 in human VSMCs results in enhanced growth of these cells. AIF1 is expressed during apoptosis rat mammary gland and ventral prostate tissues. Allograft Inflammatory Factor 1 is expressed by several tumor-associated activated macrophages and microglial cells in rat and human gliomas. There is an evident relationship of AIF1-expressing activated macrophages and microglial cells with tumor malignancy in humans.
Introduction: Human AIF1 protein shares 98% homology/identity with that of rat. AIF1 is expressed in macrophages and neutrophils. The expression of AIF1 transcripts is upregulated by IFN-g in rat macrophages. AIF1 is expressed selectively in human macrophage-like cell lines, and in a subset of CD68(+) macrophages in the interstitial and perivascular spaces of human heart allografts. In quiescent cultured human vascular smooth muscle cells synthesis of AIF1 is induced by IFN-g, IL1b, and conditioned medium of T-cells. Overexpression of AIF1 in human VSMCs results in enhanced growth of these cells. AIF1 is expressed during apoptosis rat mammary gland and ventral prostate tissues. Allograft Inflammatory Factor 1 is expressed by several tumor-associated activated macrophages and microglial cells in rat and human gliomas. There is an evident relationship of AIF1-expressing activated macrophages and microglial cells with tumor malignancy in humans.
Product Categories/Family for AIF1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
14,617 Da
NCBI Official Full Name
allograft inflammatory factor 1 isoform 3
NCBI Official Synonym Full Names
allograft inflammatory factor 1
NCBI Official Symbol
AIF1
NCBI Official Synonym Symbols
IBA1; IRT1; AIF-1; IRT-1
NCBI Protein Information
allograft inflammatory factor 1; allograft inflammatory factor-1 splice variant Hara-1; interferon gamma responsive transcript; ionized calcium-binding adapter molecule 1; protein G1
UniProt Protein Name
Allograft inflammatory factor 1
UniProt Gene Name
AIF1
UniProt Synonym Gene Names
G1; IBA1; AIF-1
UniProt Entry Name
AIF1_HUMAN
Similar Products
Product Notes
The AIF1 aif1 (Catalog #AAA38736) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MKHHHHH HASQTR DLQGGKAF&s hy;GLLKAQQ EERLDE­ ;INKQFLDDP KYSSDED&sh y;LPSKLEGF KEKYMEF&sh y;DLNGNGDI DIMSLKRMLE KLGVP KTHLELKKLI GEVSS GSGETFSYP& shy;DFLRMM LGKRSAIL&s hy;KMILMYE EKAREKEK&s hy;PTGPPAK KAISELP. It is sometimes possible for the material contained within the vial of "Allograft Inflammatory Factor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.