Retinal dehydrogenase 1 (Aldh1a1) Recombinant Protein | Aldh1a1 recombinant protein
Recombinant Mouse Retinal dehydrogenase 1 (Aldh1a1)
Gene Names
Aldh1a1; E1; Ahd2; Ahd-2; Aldh1; Raldh1; Aldh1a2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Retinal dehydrogenase 1 (Aldh1a1); N/A; Recombinant Mouse Retinal dehydrogenase 1 (Aldh1a1); Aldh1a1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-501aa; Full Length of Mature Protein
Sequence
SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Aldh1a1 recombinant protein
This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56.3 kDa
NCBI Official Full Name
retinal dehydrogenase 1
NCBI Official Synonym Full Names
aldehyde dehydrogenase family 1, subfamily A1
NCBI Official Symbol
Aldh1a1
NCBI Official Synonym Symbols
E1; Ahd2; Ahd-2; Aldh1; Raldh1; Aldh1a2
NCBI Protein Information
retinal dehydrogenase 1
UniProt Protein Name
Retinal dehydrogenase 1
UniProt Gene Name
Aldh1a1
UniProt Synonym Gene Names
RALDH 1Curated; RalDH1Curated
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Aldh1a1 aldh1a1 (Catalog #AAA114070) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-501aa; Full Length of Mature Protein. The amino acid sequence is listed below: SSPAQPAVPA PLADLKIQHT KIFINNEWHN SVSGKKFPVL NPATEEVICH VEEGDKADVD KAVKAARQAF QIGSPWRTMD ASERGRLLNK LADLMERDRL LLATMEALNG GKVFANAYLS DLGGCIKALK YCAGWADKIH GQTIPSDGDI FTYTRREPIG VCGQIIPWNF PMLMFIWKIG PALSCGNTVV VKPAEQTPLT ALHLASLIKE AGFPPGVVNI VPGYGPTAGA AISSHMDVDK VAFTGSTQVG KLIKEAAGKS NLKRVTLELG GKSPCIVFAD ADLDIAVEFA HHGVFYHQGQ CCVAASRIFV EESVYDEFVK RSVERAKKYV LGNPLTPGIN QGPQIDKEQH DKILDLIESG KKEGAKLECG GGRWGNKGFF VQPTVFSNVT DEMRIAKEEI FGPVQQIMKF KSVDDVIKRA NNTTYGLAAG LFTKDLDKAI TVSSALQAGV VWVNCYMMLS AQCPFGGFKM SGNGRELGEH GLYEYTELKT VAMKISQKNS. It is sometimes possible for the material contained within the vial of "Retinal dehydrogenase 1 (Aldh1a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
