SDS-PAGE
Intestinal-type alkaline phosphatase (ALPI) Recombinant Protein | ALPI recombinant protein
Recombinant Human Intestinal-type alkaline phosphatase (ALPI)
Gene Names
ALPI; IAP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intestinal-type alkaline phosphatase (ALPI); N/A; Recombinant Human Intestinal-type alkaline phosphatase (ALPI); ALPI recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-503aa; Full Length of Mature Protein
Sequence
VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTD
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for ALPI recombinant protein
There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver
bone
kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is upregulated during small intestinal epithelial cell differentiation.
bone
kidney (tissue non-specific). The intestinal alkaline phosphatase gene encodes a digestive brush-border enzyme. This enzyme is upregulated during small intestinal epithelial cell differentiation.
Product Categories/Family for ALPI recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54.4 kDa
NCBI Official Full Name
intestinal-type alkaline phosphatase
NCBI Official Synonym Full Names
alkaline phosphatase, intestinal
NCBI Official Symbol
ALPI
NCBI Official Synonym Symbols
IAP
NCBI Protein Information
intestinal-type alkaline phosphatase
UniProt Protein Name
Intestinal-type alkaline phosphatase
UniProt Gene Name
ALPI
UniProt Synonym Gene Names
IAP; Intestinal alkaline phosphatase
Similar Products
Product Notes
The ALPI alpi (Catalog #AAA113349) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-503aa; Full Length of Mature Protein. The amino acid sequence is listed below: VIPAEEENPA FWNRQAAEAL DAAKKLQPIQ KVAKNLILFL GDGLGVPTVT ATRILKGQKN GKLGPETPLA MDRFPYLALS KTYNVDRQVP DSAATATAYL CGVKANFQTI GLSAAARFNQ CNTTRGNEVI SVMNRAKQAG KSVGVVTTTR VQHASPAGTY AHTVNRNWYS DADMPASARQ EGCQDIATQL ISNMDIDVIL GGGRKYMFPM GTPDPEYPAD ASQNGIRLDG KNLVQEWLAK HQGAWYVWNR TELMQASLDQ SVTHLMGLFE PGDTKYEIHR DPTLDPSLME MTEAALRLLS RNPRGFYLFV EGGRIDHGHH EGVAYQALTE AVMFDDAIER AGQLTSEEDT LTLVTADHSH VFSFGGYTLR GSSIFGLAPS KAQDSKAYTS ILYGNGPGYV FNSGVRPDVN ESESGSPDYQ QQAAVPLSSE THGGEDVAVF ARGPQAHLVH GVQEQSFVAH VMAFAACLEP YTACDLAPPA CTTD. It is sometimes possible for the material contained within the vial of "Intestinal-type alkaline phosphatase (ALPI), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.