ANGPTL4 recombinant protein
ANGPTL4 protein
Applications
Western Blot, SDS-Page, ELISA
Purity
> 90% pure
Synonyms
ANGPTL4; N/A; ANGPTL4 protein; Angiopoietin like 4 protein, Hepatic fibrinogen/angiopoietin related protein, HFARP protein, Angiopoietin related 4 protein, ANGPTL 4 protein, ANGPTL-4 protein; ANGPTL4 recombinant protein
Host
Human
Purity/Purification
> 90% pure
Form/Format
Supplied in liquid form in PBS buffer with 20 mM GSH
Sequence Positions
28-403aa
Sequence
VQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAE
Applicable Applications for ANGPTL4 recombinant protein
WB (Western Blot), SDS-PAGE, ELISA
Expression System
E.coli
Species
Human
Protein Type
Recombinant
Biological Significance
ANGPTL4 is a protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorgenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM).
Tag
N terminal GST tag
Preparation and Storage
Store at 4 degree C in a working aliquot for 1 week. For long term storage, aliquot and freeze at -20 to -80 degree C, avoid repeat freeze/thaw cycles
Related Product Information for ANGPTL4 recombinant protein
Purified recombinant ANGPTL4 protein
Product Categories/Family for ANGPTL4 recombinant protein
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ANGPTL4 (Catalog #AAA224546) is a Recombinant Protein produced from Human and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-403aa. AAA Biotech's ANGPTL4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), SDS-PAGE, ELISA. Researchers should empirically determine the suitability of the ANGPTL4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VQSKSPRFAS WDEMNVLAHG LLQLGQGLRE HAERTRSQLS ALERRLSACG SACQGTEGST DLPLAPESRV DPEVLHSLQT QLKAQNSRIQ QLFHKVAQQQ RHLEKQHLRI QHLQSQFGLL DHKHLDHEVA KPARRKRLPE MAQPVDPAHN VSRLHRLPRD CQELFQVGER QSGLFEIQPQ GSPPFLVNCK MTSDGGWTVI QRRHDGSVDF NRPWEAYKAG FGDPHGEFWL GLEKVHSITG DRNSRLAVQL RDWDGNAELL QFSVHLGGED TAYSLQLTAP VAGQLGATTV PPSGLSVPFS TWDQDHDLRR DKNCAKSLSG GWWFGTCSHS NLNGQYFRSI PQQRQKLKKG IFWKTWRGRY YPLQATTMLI QPMAAE. It is sometimes possible for the material contained within the vial of "ANGPTL4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
