Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

3-Acetylpyridine-Adenine Dinucleotide, Oxidized Substrate | APAD substrate

3-Acetylpyridine-Adenine Dinucleotide, Oxidized (APAD)

Purity
92%
Synonyms
3-Acetylpyridine-Adenine Dinucleotide, Oxidized; N/A; 3-Acetylpyridine-Adenine Dinucleotide, Oxidized (APAD); APAD; APAD substrate
Ordering
Purity/Purification
92%
Form/Format
Lyophilized Powder
Sequence
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
CAS No
86-08-8
Formula Weight
662.4 (as anhydrous free acid)
680.5 (as monohydrate)
Formula
C22H28N6O14P2
Water Contents
2.7%
APAD* contents
89.5%
Spectral Analysis
Ratio at pH 7.5:
A250/A260: 0.81
A280/A260: 0.22
Preparation and Storage
Shor-term storage : 1-10 degree C
Long-term storage: below - 20 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Categories/Family for APAD substrate

Similar Products

Product Notes

The APAD (Catalog #AAA14928) is a Substrate and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MEKVQYLTRS AIRRASTIEM PQQARQKLQN LFINFCLILI CLLLICIIVM LL. It is sometimes possible for the material contained within the vial of "3-Acetylpyridine-Adenine Dinucleotide, Oxidized, Substrate" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.