SDS-PAGE
Apolipoprotein A-V Recombinant Protein | Apoa5 recombinant protein
Recombinant Rat Apolipoprotein A-V
Gene Names
Apoa5; apo-AV; apoA-V
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein A-V; N/A; Recombinant Rat Apolipoprotein A-V; Apolipoprotein A5; Regeneration-associated protein 3; Apoa5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-367aa; Partial of Isoform 3
Sequence
RKSFWEYFGQNSQGKGMMGQQQKLAQESLKGSLEQDLYNMNNFLEKLGPLREPGKEPPRLAQDPEGIRKQLQQELEEVSTRLEPYMAAKHQQVGWNLEGLRQQLKPYTVELMEQVGLSVQDLQEQLRMVGKGTKAQLLGGVDEAMSLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAVASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSTFIRVSTDGADNRDSLDPQALSDEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLHDQGHSQNNPEGHSG
Sequence Length
367
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Apoa5 recombinant protein
Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and a inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages.
References
Apolipoprotein A-V. A novel apolipoprotein associated with an early phase of liver regeneration.van Der Vliet H.N., Sammels M.G., Leegwater A.C.J., Levels J.H.M., Reitsma P.H., Boers W., Chamuleau R.A.F.M.J. Biol. Chem. 276:44512-44520(2001)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66.4 kDa
NCBI Official Full Name
apolipoprotein A-V
NCBI Official Synonym Full Names
apolipoprotein A-V
NCBI Official Symbol
Apoa5
NCBI Official Synonym Symbols
apo-AV; apoA-V
NCBI Protein Information
apolipoprotein A-V
UniProt Protein Name
Apolipoprotein A-V
UniProt Gene Name
Apoa5
UniProt Synonym Gene Names
Rap3; Apo-AV; ApoA-V
UniProt Entry Name
APOA5_RAT
Similar Products
Product Notes
The Apoa5 apoa5 (Catalog #AAA117353) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-367aa; Partial of Isoform 3. The amino acid sequence is listed below: RKSFWEYFGQ NSQGKGMMGQ QQKLAQESLK GSLEQDLYNM NNFLEKLGPL REPGKEPPRL AQDPEGIRKQ LQQELEEVST RLEPYMAAKH QQVGWNLEGL RQQLKPYTVE LMEQVGLSVQ DLQEQLRMVG KGTKAQLLGG VDEAMSLLQD MQSRVLHHTD RVKELFHPYA ERLVTGIGHH VQELHRSVAP HAVASPARLS RCVQTLSHKL TRKAKDLHTS IQRNLDQLRD ELSTFIRVST DGADNRDSLD PQALSDEVRQ RLQAFRHDTY LQIAAFTQAI DQETEEIQHQ LAPPPPSHSA FAPELGHSDS NKALSRLQSR LDDLWEDIAY GLHDQGHSQN NPEGHSG. It is sometimes possible for the material contained within the vial of "Apolipoprotein A-V, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.