Apolipoprotein C-I (Apoc1) Recombinant Protein | Apoc1 recombinant protein
Recombinant Mouse Apolipoprotein C-I (Apoc1)
Gene Names
Apoc1; apo-CI; apoC-I; Apo-CIB; ApoC-IB
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein C-I (Apoc1); N/A; Recombinant Mouse Apolipoprotein C-I (Apoc1); Apolipoprotein C1; Apoc1 recombinant protein
Host
In Vitro E Coli Expression System
Specificity
Adult and fetal liver.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Tris-Based Buffer, 50% Glycerol
Sequence Positions
27-88aa; Full Length of Mature Protein
Sequence
APDLSGTLESIPDKLKEFGNTLEDKARAAIEHIKQKEILTKTRAWFSEAFGKVKEKLKTTFS
Species
Mouse
Tag
N-terminal 10xHis-tagged
Subcellular Location
Secreted
Protein Families
Apolipoprotein C1 family
Production Note
Special Offer: The Cell Free host-expressed protein is manufactured from a stock plasmid containing the protein gene. Cell Freehost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Cell Free host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Cell Free host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Apoc1 recombinant protein
Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein (By similarity). Binds free fatty acids and reduces their intracellular esterification.
Product Categories/Family for Apoc1 recombinant protein
References
"Mass spectral analysis of the apolipoproteins on mouse high density lipoproteins. Detection of post-translational modifications." Puppione D.L., Yam L.M., Bassilian S., Souda P., Castellani L.W., Schumaker V.N., Whitelegge J.P. Biochim. Biophys. Acta 1764:1363-1371(2006).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.5 kDa
NCBI Official Full Name
apolipoprotein C-I
NCBI Official Synonym Full Names
apolipoprotein C-I
NCBI Official Symbol
Apoc1
NCBI Official Synonym Symbols
apo-CI; apoC-I; Apo-CIB; ApoC-IB
NCBI Protein Information
apolipoprotein C-I
UniProt Protein Name
Apolipoprotein C-I
UniProt Gene Name
Apoc1
UniProt Synonym Gene Names
Apoc1b; Apo-CIB; ApoC-IB; Apo-CIB'; ApoC-IB'
UniProt Entry Name
APOC1_MOUSE
Similar Products
Product Notes
The Apoc1 apoc1 (Catalog #AAA235630) is a Recombinant Protein produced from In Vitro E Coli Expression System and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-88aa; Full Length of Mature Protein. The amino acid sequence is listed below: APDLSGTLES IPDKLKEFGN TLEDKARAAI EHIKQKEILT KTRAWFSEAF GKVKEKLKTT FS. It is sometimes possible for the material contained within the vial of "Apolipoprotein C-I (Apoc1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.