SDS-PAGE
Apolipoprotein C-III (Apoc3) Recombinant Protein | Apoc3 recombinant protein
Recombinant Rat Apolipoprotein C-III (Apoc3)
Gene Names
Apoc3; ApoC-III; apo-CIII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Apolipoprotein C-III (Apoc3); N/A; Recombinant Rat Apolipoprotein C-III (Apoc3); Apoc3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-101aa, Full Length of Mature Protein
Sequence
DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP
Sequence Length
101
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for Apoc3 recombinant protein
Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
11 kDa
NCBI Official Full Name
Apolipoprotein C-III
NCBI Official Synonym Full Names
apolipoprotein C3
NCBI Official Symbol
Apoc3
NCBI Official Synonym Symbols
ApoC-III; apo-CIII
NCBI Protein Information
apolipoprotein C-III
UniProt Protein Name
Apolipoprotein C-III
UniProt Gene Name
Apoc3
UniProt Synonym Gene Names
Apo-CIII; ApoC-III
Similar Products
Product Notes
The Apoc3 apoc3 (Catalog #AAA113176) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-101aa, Full Length of Mature Protein. The amino acid sequence is listed below: DEGEGSLLLG SMQGYMEQAS KTVQDALSSM QESDIAVVAS RGWMDNRFKS LKGYWSKFTD KFTGLWESGP EDQLTTPTLE P. It is sometimes possible for the material contained within the vial of "Apolipoprotein C-III (Apoc3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.