L-ascorbate peroxidase 2, cytosolic (APX2) Recombinant Protein | APX2 recombinant protein
Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial
Gene Names
APX2; APX1B; ASCORBATE PEROXIDASE 1B; ascorbate peroxidase 2; CS2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-ascorbate peroxidase 2, cytosolic (APX2); N/A; Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial; L-ascorbate peroxidase 1b ; APX1b ; AtAPx02; APX2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
4-250aa; Partial
Sequence
KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK
Species
Arabidopsis thaliana (Mouse-ear cress)
Subcellular Location
Cytoplasm
Protein Families
Peroxidase family, Ascorbate peroxidase subfamily
Tissue Specificity
Detected in bundle sheath cells, the photosynthetic cells that surround the phloem and xylem.
Relevance
Plays a key role in hydrogen peroxide roval.
Function
Plays a key role in hydrogen peroxide removal.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for APX2 recombinant protein
References
Cytosolic ascorbate peroxidase from Arabidopsis thaliana L. is encoded by a small multigene family.Santos M., Gosseau H., Lister C., Foyer C., Creissen G.P., Mullineaux P.M.Planta 198:64-69(1996)
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=At&CID=129
https://www.genome.jp/dbget-bin/www_bget?ath:AT3G09640
https://string-db.org/network/3702.AT3G09640.1
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=At&CID=129
https://www.genome.jp/dbget-bin/www_bget?ath:AT3G09640
https://string-db.org/network/3702.AT3G09640.1
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,006 Da
NCBI Official Full Name
ascorbate peroxidase 2
NCBI Official Symbol
APX2
NCBI Official Synonym Symbols
APX1B; ASCORBATE PEROXIDASE 1B; ascorbate peroxidase 2; CS2
NCBI Protein Information
ascorbate peroxidase 2
UniProt Protein Name
L-ascorbate peroxidase 2, cytosolic
UniProt Gene Name
APX2
UniProt Synonym Gene Names
APX1B; APX1b; AtAPx02
Similar Products
Product Notes
The APX2 apx2 (Catalog #AAA278933) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-250aa; Partial. The amino acid sequence is listed below: KSYPEVKEEY KKAVQRCKRK LRGLIAEKHC APIVLRLAWH SAGTFDVKTK TGGPFGTIRH PQELAHDANN GLDIAVRLLD PIKELFPILS YADFYQLAGV VAVEITGGPE IPFHPGRLDK VEPPPEGRLP QATKGVDHLR DVFGRMGLND KDIVALSGGH TLGRCHKERS GFEGAWTPNP LIFDNSYFKE ILSGEKEGLL QLPTDKALLD DPLFLPFVEK YAADEDAFFE DYTEAHLKLS ELGFADK. It is sometimes possible for the material contained within the vial of "L-ascorbate peroxidase 2, cytosolic (APX2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.