Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

ADP-ribosylation factor 4 (ARF4) Recombinant Protein | ARF4 recombinant protein

Recombinant Human ADP-ribosylation factor 4 (ARF4)

Average rating 0.0
No ratings yet
Gene Names
ARF4; ARF2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ADP-ribosylation factor 4 (ARF4); N/A; Recombinant Human ADP-ribosylation factor 4 (ARF4); ARF4 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-180, Full length protein
Sequence
GLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR
Sequence Length
179
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ARF4 recombinant protein
This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
378
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,511 Da
NCBI Official Full Name
ADP-ribosylation factor 4
NCBI Official Synonym Full Names
ADP ribosylation factor 4
NCBI Official Symbol
ARF4
NCBI Official Synonym Symbols
ARF2
NCBI Protein Information
ADP-ribosylation factor 4
UniProt Protein Name
ADP-ribosylation factor 4
UniProt Gene Name
ARF4
UniProt Synonym Gene Names
ARF2

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ARF4 arf4 (Catalog #AAA113323) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-180, Full length protein. The amino acid sequence is listed below: GLTISSLFSR LFGKKQMRIL MVGLDAAGKT TILYKLKLGE IVTTIPTIGF NVETVEYKNI CFTVWDVGGQ DRIRPLWKHY FQNTQGLIFV VDSNDRERIQ EVADELQKML LVDELRDAVL LLFANKQDLP NAMAISEMTD KLGLQSLRNR TWYVQATCAT QGTGLYEGLD WLSNELSKR. It is sometimes possible for the material contained within the vial of "ADP-ribosylation factor 4 (ARF4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.