Asialoglycoprotein receptor 1 Recombinant Protein | Asgr1 recombinant protein
Recombinant Mouse Asialoglycoprotein receptor 1
Gene Names
Asgr1; Asgr; HL-1; ASGPR1; Asgr-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Asialoglycoprotein receptor 1; N/A; Recombinant Mouse Asialoglycoprotein receptor 1; Hepatic lectin 1; HL-1; mHL-1; Asgr1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
61-284aa; Extracellular Domain
Sequence
QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Sequence Length
284
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Asgr1 recombinant protein
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been roved. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
References
Determination of mouse major asialoglycoprotein receptor cDNA sequence.Takezawa R., Shinzawa K., Watanabe Y., Akaike T.Biochim. Biophys. Acta 1172:220-222(1993) The major form of the murine asialoglycoprotein receptor cDNA sequence and expression in liver, testis and epididymis.Monroe R.S., Huber B.E.Gene 148:237-244(1994) Organization of the mouse ASGR1 gene encoding the major subunit of the hepatic asialoglycoprotein receptor.Soukharev S., Berlin W., Hanover J.A., Bethke B., Sauer B.Gene 241:233-240(2000) Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
27.8 kDa
NCBI Official Synonym Full Names
asialoglycoprotein receptor 1
NCBI Official Symbol
Asgr1
NCBI Official Synonym Symbols
Asgr; HL-1; ASGPR1; Asgr-1
NCBI Protein Information
asialoglycoprotein receptor 1
UniProt Protein Name
Asialoglycoprotein receptor 1
UniProt Gene Name
Asgr1
UniProt Synonym Gene Names
Asgr-1; ASGP-R 1; ASGPR 1; HL-1; mHL-1
UniProt Entry Name
ASGR1_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Asgr1 asgr1 (Catalog #AAA113597) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 61-284aa; Extracellular Domain. The amino acid sequence is listed below: QNSQLREDLL ALRQNFSNLT VSTEDQVKAL STQGSSVGRK MKLVESKLEK QQKDLTEDHS SLLLHVKQLV SDVRSLSCQM AAFRGNGSER TCCPINWVEY EGSCYWFSSS VRPWTEADKY CQLENAHLVV VTSRDEQNFL QRHMGPLNTW IGLTDQNGPW KWVDGTDYET GFQNWRPEQP DNWYGHGLGG GEDCAHFTTD GRWNDDVCRR PYRWVCETKL DKAN. It is sometimes possible for the material contained within the vial of "Asialoglycoprotein receptor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
