Asialoglycoprotein receptor 2 (Asgr2) Recombinant Protein | Asgr2 recombinant protein
Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial
Gene Names
Asgr2; Asgr; HL-2; ASGPR2; Asgr-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Asialoglycoprotein receptor 2 (Asgr2); N/A; Recombinant Mouse Asialoglycoprotein receptor 2 (Asgr2), partial; Asgr2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
80-301aa; Partial
Sequence
QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Asgr2 recombinant protein
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Product Categories/Family for Asgr2 recombinant protein
References
"Mouse asialoglycoprotein receptor cDNA sequence: conservation of receptor genes during mammalian evolution." Sanford J.P., Doyle D. Biochim. Biophys. Acta 1087:259-261(1990)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.9 kDa
NCBI Official Full Name
asialoglycoprotein receptor 2 isoform a
NCBI Official Synonym Full Names
asialoglycoprotein receptor 2
NCBI Official Symbol
Asgr2
NCBI Official Synonym Symbols
Asgr; HL-2; ASGPR2; Asgr-2
NCBI Protein Information
asialoglycoprotein receptor 2
UniProt Protein Name
Asialoglycoprotein receptor 2
UniProt Gene Name
Asgr2
UniProt Synonym Gene Names
Asgr-2; ASGP-R 2; ASGPR 2; HL-2; mHL-2
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Asgr2 asgr2 (Catalog #AAA113600) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 80-301aa; Partial. The amino acid sequence is listed below: QSIQLQEEFR TLKETFSNFS SSTLMEFGAL DTLGGSTNAI LTSWLAQLEE KQQQLKADHS TLLFHLKHFP MDLRTLTCQL AYFQSNGTEC CPVNWVEFGG SCYWFSRDGL TWAEADQYCQ LENAHLLVIN SREEQDFVVK HRSQFHIWIG LTDRDGSWKW VDGTDYRSNY RNWAFTQPDN WQGHEQGGGE DCAEILSDGH WNDNFCQQVN RWVCEKRRNI TH. It is sometimes possible for the material contained within the vial of "Asialoglycoprotein receptor 2 (Asgr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.