Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA117561_SDS_PAGE15.jpg SDS-PAGE

Atonal homolog 1 Recombinant Protein | ATOH1 recombinant protein

Recombinant Human Protein atonal homolog 1

Gene Names
ATOH1; ATH1; HATH1; MATH-1; bHLHa14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Atonal homolog 1; N/A; Recombinant Human Protein atonal homolog 1; Class A basic helix-loop-helix protein 14; bHLHa14; Helix-loop-helix protein hATH-1; hATH1; ATOH1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354aa; Full Length
Sequence
MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Sequence Length
354
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA117561_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for ATOH1 recombinant protein
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Product Categories/Family for ATOH1 recombinant protein
References
Evolutionary conservation of sequence and expression of the bHLH protein Atonal suggests a conserved role in neurogenesis.Ben-Arie N., McCall A.E., Berkman S., Eichele G., Bellen H.J., Zoghbi H.Y.Hum. Mol. Genet. 5:1207-1216(1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
474
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54.2 kDa
NCBI Official Full Name
protein atonal homolog 1
NCBI Official Synonym Full Names
atonal bHLH transcription factor 1
NCBI Official Symbol
ATOH1
NCBI Official Synonym Symbols
ATH1; HATH1; MATH-1; bHLHa14
NCBI Protein Information
protein atonal homolog 1
UniProt Protein Name
Protein atonal homolog 1
UniProt Gene Name
ATOH1
UniProt Synonym Gene Names
ATH1; BHLHA14; bHLHa14; hATH1
UniProt Entry Name
ATOH1_HUMAN

Similar Products

Product Notes

The ATOH1 atoh1 (Catalog #AAA117561) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354aa; Full Length. The amino acid sequence is listed below: MSRLLHAEEW AEVKELGDHH RQPQPHHLPQ PPPPPQPPAT LQAREHPVYP PELSLLDSTD PRAWLAPTLQ GICTARAAQY LLHSPELGAS EAAAPRDEVD GRGELVRRSS GGASSSKSPG PVKVREQLCK LKGGVVVDEL GCSRQRAPSS KQVNGVQKQR RLAANARERR RMHGLNHAFD QLRNVIPSFN NDKKLSKYET LQMAQIYINA LSELLQTPSG GEQPPPPPAS CKSDHHHLRT AASYEGGAGN ATAAGAQQAS GGSQRPTPPG SCRTRFSAPA SAGGYSVQLD ALHFSTFEDS ALTAMMAQKN LSPSLPGSIL QPVQEENSKT SPRSHRSDGE FSPHSHYSDS DEAS. It is sometimes possible for the material contained within the vial of "Atonal homolog 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.