Potassium-transporting ATPase subunit beta (ATP4B) Recombinant Protein | ATP4B recombinant protein

Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial

Cat. Num. AAA18511

• Gene Names: ATP4B; ATP6B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium-transporting ATPase subunit beta (ATP4B); N/A; Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial; Gastric H(+)/K(+) ATPase subunit beta; Proton pump beta chain; ATP4B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 58-291. Partial
• Sequence: CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for ATP4B recombinant protein

Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.

Product Categories/Family for ATP4B recombinant protein

Transport

References

cDNA cloning of the beta-subunit of the human gastric H,K-ATPase.Ma J.-Y., Song Y.-H., Sjoestrand S.E., Rask L., Maardh S.Biochem. Biophys. Res. Commun. 180:39-45(1991) The DNA sequence and analysis of human chromosome 13.Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T., Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.Nature 428:522-528(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 4557339
• NCBI GeneID: 496
• NCBI Accession #: NP_000696.1
• NCBI GenBank Nucleotide #: NM_000705.3
• UniProt Accession #: P51164; B1B0N8
• Molecular Weight: 28.6 kDa
• NCBI Official Full Name: potassium-transporting ATPase subunit beta
• NCBI Official Synonym Full Names: ATPase H+/K+ transporting beta subunit
• NCBI Official Symbol: ATP4B
• NCBI Official Synonym Symbols: ATP6B
• NCBI Protein Information: potassium-transporting ATPase subunit beta
• UniProt Protein Name: Potassium-transporting ATPase subunit beta
• UniProt Gene Name: ATP4B
• UniProt Entry Name: ATP4B_HUMAN