ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB) Recombinant Protein | ATP5PB recombinant protein
Recombinant Human ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB)
Gene Names
ATP5PB; PIG47; ATP5F1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB); N/A; Recombinant Human ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB); ATP5PB recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
43-256aa; Full Length of Mature Protein
Sequence
PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ATP5PB recombinant protein
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the b subunit of the proton channel.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,909 Da
NCBI Official Full Name
ATP synthase F(0) complex subunit B1, mitochondrial
NCBI Official Synonym Full Names
ATP synthase peripheral stalk-membrane subunit b
NCBI Official Symbol
ATP5PB
NCBI Official Synonym Symbols
PIG47; ATP5F1
NCBI Protein Information
ATP synthase F(0) complex subunit B1, mitochondrial
UniProt Protein Name
ATP synthase F(0) complex subunit B1, mitochondrial
UniProt Gene Name
ATP5F1
UniProt Synonym Gene Names
ATPase subunit b
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ATP5PB atp5f1 (Catalog #AAA113605) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 43-256aa; Full Length of Mature Protein. The amino acid sequence is listed below: PVPPLPEYGG KVRYGLIPEE FFQFLYPKTG VTGPYVLGTG LILYALSKEI YVISAETFTA LSVLGVMVYG IKKYGPFVAD FADKLNEQKL AQLEEAKQAS IQHIQNAIDT EKSQQALVQK RHYLFDVQRN NIAMALEVTY RERLYRVYKE VKNRLDYHIS VQNMMRRKEQ EHMINWVEKH VVQSISTQQE KETIAKCIAD LKLLAKKAQA QPVM. It is sometimes possible for the material contained within the vial of "ATP synthase F (0) complex subunit B1, mitochondrial (ATP5PB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.