ATP synthase subunit f, mitochondrial (ATP5J2) Recombinant Protein | ATP5MF recombinant protein
Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)
Gene Names
ATP5J2; ATP5JL
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
ATP synthase subunit f, mitochondrial (ATP5J2); N/A; Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2); ATP synthase membrane subunit f; ATP5MF recombinant protein
Host
in vitro E coli expression system
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Liquid or Lyophilized powder
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8
Sequence Positions
1-94aa; Full Length Protein
Sequence
MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
Species
Homo sapiens (Human)
Tag
N-terminal 10xHis-tagged
Research Area
Others
Transmembrane Domain
1TM
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ATP5MF recombinant protein
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane.
Product Categories/Family for ATP5MF recombinant protein
References
"Dimer ribbons of ATP synthase shape the inner mitochondrial membrane."Strauss M., Hofhaus G., Schroder R.R., Kuhlbrandt W.EMBO J 27:1154-1160(2008)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10,918 Da
NCBI Official Full Name
ATP synthase subunit f, mitochondrial isoform 2b
NCBI Official Synonym Full Names
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2
NCBI Official Symbol
ATP5J2
NCBI Official Synonym Symbols
ATP5JL
NCBI Protein Information
ATP synthase subunit f, mitochondrial; F1F0-type ATPase subunit f; F1Fo-ATPase synthase f subunit; ATP synthase f chain, mitochondrial; F1Fo-ATP synthase complex Fo membrane domain f subunit; ATP synthase, H+ transporting, mitochondrial F0 complex, subuni
UniProt Protein Name
ATP synthase subunit f, mitochondrial
UniProt Gene Name
ATP5J2
UniProt Synonym Gene Names
ATP5JL
UniProt Entry Name
ATPK_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ATP5MF atp5j2 (Catalog #AAA279283) is a Recombinant Protein produced from in vitro E coli expression system and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-94aa; Full Length Protein. The amino acid sequence is listed below: MASVGECPAP VPVKDKKLLE VKLGELPSWI LMRDFSPSGI FGAFQRGYYR YYNKYINVKK GSISGITMVL ACYVLFSYSF SYKHLKHERL RKYH. It is sometimes possible for the material contained within the vial of "ATP synthase subunit f, mitochondrial (ATP5J2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
