SDS-PAGE
ATP synthase subunit c (atpE) Recombinant Protein | Clos_2565 recombinant protein
Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP synthase subunit c (atpE); N/A; Recombinant Alkaliphilus oremlandii ATP synthase subunit c (atpE); Recombinant ATP synthase subunit c (atpE); ATP synthase subunit c; ATP synthase F(0) sector subunit c F-type ATPase subunit c; F-ATPase subunit c Lipid-binding protein; Clos_2565 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-88
Sequence
MEGITGKELILAASAIGAGLAMIAGLGPGIGQGIAAGKGAEAVGRQPEAQGDILRTMLLGQAVAETTGIYSLVIALILLFANPLIRLL
Sequence Length
88
Species
Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs))
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-PAGE
SDS-PAGE
Related Product Information for Clos_2565 recombinant protein
F1F0 ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F1 containing the extramembraneous catalytic core and F0 containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation.Key component of the F0 channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F1 delta and epsilon subunits .
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35kD
NCBI Official Full Name
F0F1 ATP synthase subunit C
NCBI Official Symbol
Clos_2565
NCBI Protein Information
F0F1 ATP synthase subunit C
UniProt Protein Name
ATP synthase subunit c
UniProt Gene Name
atpE
UniProt Synonym Gene Names
F-ATPase subunit c
UniProt Entry Name
ATPL_ALKOO
Similar Products
Product Notes
The Clos_2565 atpe (Catalog #AAA114313) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-88. The amino acid sequence is listed below: MEGITGKELI LAASAIGAGL AMIAGLGPGI GQGIAAGKGA EAVGRQPEAQ GDILRTMLLG QAVAETTGIY SLVIALILLF ANPLIRLL. It is sometimes possible for the material contained within the vial of "ATP synthase subunit c (atpE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.