Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Wheat Gliadin Gamma Recombinant Protein | BathyCg00315 recombinant protein

Recombinant Wheat Gliadin Gamma

Average rating 0.0
No ratings yet
Purity
Protein is >90% pure.
Synonyms
Wheat Gliadin Gamma; N/A; Recombinant Wheat Gliadin Gamma; Gliadin Gamma Wheat; Gliadin Gamma Wheat Recombinant; BathyCg00315 recombinant protein
Ordering
Host
E. Coli
Purity/Purification
Protein is >90% pure.
Form/Format
Gliadin Gamma protein solution (1mg/ml) in 10mM Tris-HCL pH7.2
Sequence
MKTLLILTILAMAITIGTANIQVDPSGQVQWLQQQLVPQLQQPLSQQPQQTFPQPQQTFPHQPQQQVPQPQQPQQPFLQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQQPQQPFPQTQQPQQPFPQLQQPQQPFPQPQQQLPQPQQPQQSFPQQQRPFIQPSLQQQLNCKNILLQQSKPASLVSSLWSIIWPQSDCQVMRQQCCQQLAQIPQQLQCAAIHSVVHSIIMQQQQQQQQQQGIDIFLPLSQHEQVGQGSLVQGQGIIQPQQPAQLEAIRSLVLQTLPSMCNVYVPPECSIMRAPFASIVAGIGGQHHHHHH
Sequence Length
77
Physical Appearance
Sterile Filtered clear solution.
Preparation and Storage
Gliadin Gamma although stable at 4 degree C for 1 week, should be stored below -18 degree C. Please prevent freeze thaw cycles.
Related Product Information for BathyCg00315 recombinant protein
Introduction: Wheat Gliadin and related gluten components from barley, rye and possibly oats can cause an abnormal immune response called Celiac disease which is a chronic gastrointestinal disorder. Celiac disease characteristics are flattening of the jejunal mucosa and intestinal lesions of variable severity in hereditarily inclined individuals. Even though Celiac disease is not a classic autoimmune disease it is related to anti-tissue transglutaminase antibodies and gliadin antibodies tests are most recommended in screening populations at risk for CD and other gluten-sensitive enteropathies. In the past, serologic tests for gliadin antibodies usually were not very precise and were not enough for accurate identification due to missing deamidated epitopes within the authentic gliadin fraction traditionally used in test kits. Deamidated Gliadin isoform matches to the deamidated neo-epitopes, which in the natural antigen are formed by transglutaminase-mediated glutamine side chain deamidation.

Description: Recombinant Wheat Gliadin Gamma protein produced in E Coli and fused to a 6 His Tag at C-terminus, having a theoretical Mw of 37945.14 Dalton, pI 7.70.Purified by proprietary chromatographic technique.
Product Categories/Family for BathyCg00315 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9,220 Da
NCBI Official Full Name
n/a (chloroplast)
NCBI Official Symbol
BathyCg00315
UniProt Gene Name
BathyCg00315
UniProt Entry Name
K8F1J1_9CHLO

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BathyCg00315 bathycg00315 (Catalog #AAA38012) is a Recombinant Protein produced from E. Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MKTLLILTIL AMAITIGTAN IQVDPSGQVQ WLQQQLVPQL QQPLSQQPQQ TFPQPQQTFP HQPQQQVPQP QQPQQPFLQP QQPFPQQPQQ PFPQTQQPQQ PFPQQPQQPF PQTQQPQQPF PQQPQQPFPQ TQQPQQPFPQ LQQPQQPFPQ PQQQLPQPQQ PQQSFPQQQR PFIQPSLQQQ LNCKNILLQQ SKPASLVSSL WSIIWPQSDC QVMRQQCCQQ LAQIPQQLQC AAIHSVVHSI IMQQQQQQQQ QQGIDIFLPL SQHEQVGQGS LVQGQGIIQP QQPAQLEAIR SLVLQTLPSM CNVYVPPECS IMRAPFASIV AGIGGQH HHHHH. It is sometimes possible for the material contained within the vial of "Wheat Gliadin Gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.