Brain-derived neurotrophic factor (BDNF) Recombinant Protein | BDNF recombinant protein

Recombinant Human Brain-derived neurotrophic factor (BDNF), partial

Cat. Num. AAA113843

• Gene Names: BDNF; ANON2; BULN2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Brain-derived neurotrophic factor (BDNF); N/A; Recombinant Human Brain-derived neurotrophic factor (BDNF), partial; Abrineurin; BDNF recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 137-237. Partial
• Sequence: ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for BDNF recombinant protein

During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is phasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.

Product Categories/Family for BDNF recombinant protein

Neuroscience

References

Molecular cloning of a human gene that is a member of the nerve growth factor family.Jones K.R., Reichardt L.F.Proc. Natl. Acad. Sci. U.S.A. 87:8060-8064(1990) Human and rat brain-derived neurotrophic factor and neurotrophin-3 gene structures, distributions, and chromosomal localizations.Maisonpierre P.C., le Beau M.M., Espinosa R. III, Ip N.Y., Belluscio L., de la Monte S.M., Squinto S., Furth M.E., Yancopoulos G.D.Genomics 10:558-568(1991) Characterization of the 5'-flanking region of the human brain-derived neurotrophic factor gene.Shintani A., Ono Y., Kaisho Y., Igarashi K.Biochem. Biophys. Res. Commun. 182:325-332(1992) Human brain derived neurotrophic factor (BDNF) genes, splicing patterns, and assessments of associations with substance abuse and Parkinson's Disease.Liu Q.-R., Walther D., Drgon T., Polesskaya O., Lesnick T.G., Strain K.J., de Andrade M., Bower J.H., Maraganore D.M., Uhl G.R.Am. J. Med. Genet. B Neuropsychiatr. Genet. 134:93-103(2005) Dissecting the human BDNF locus bidirectional transcription, complex splicing, and multiple promoters.Pruunsild P., Kazantseva A., Aid T., Palm K., Timmusk T.Genomics 90:397-406(2007) A cDNA clone of human brain-derived neurotrophic factor (HUMBDNFD) .Cheng Y., Gu J.Wu J., Zhang B., Zhou Y., Peng X., Yuan J., Qiang B.Perez-Pinera P., Gonzalez-Martinez T., Garcia-Suarez O., Perez-Perez M., Esteban I., Monjil D., Vega J.A.Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 219842288
• NCBI GeneID: 627
• NCBI Accession #: NP_001137277.1
• NCBI GenBank Nucleotide #: NM_001143805.1
• UniProt Accession #: P23560; Q598Q1; Q6DN19; Q6YNR2; Q6YNR3; Q9BYY7; Q9UC24; A7LA85; A7LA92; D3DQZ2
• Molecular Weight: 38.5 kDa
• NCBI Official Full Name: brain-derived neurotrophic factor isoform a preproprotein
• NCBI Official Synonym Full Names: brain-derived neurotrophic factor
• NCBI Official Symbol: BDNF
• NCBI Official Synonym Symbols: ANON2; BULN2
• NCBI Protein Information: brain-derived neurotrophic factor
• UniProt Protein Name: Brain-derived neurotrophic factor
• UniProt Gene Name: BDNF
• UniProt Synonym Gene Names: BDNF
• UniProt Entry Name: BDNF_HUMAN