Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA116197_SDS_PAGE15.jpg SDS-PAGE

Brain-derived neurotrophic factor (Bdnf) Recombinant Protein | Bdnf recombinant protein

Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Brain-derived neurotrophic factor (Bdnf); N/A; Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial; Bdnf recombinant protein
Ordering
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
136-243. Partial
Sequence
RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA116197_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Bdnf recombinant protein
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS.
References
Human and rat brain-derived neurotrophic factor and neurotrophin-3 gene structures, distributions, and chromosomal localizations.Maisonpierre P.C., le Beau M.M., Espinosa R. III, Ip N.Y., Belluscio L., de la Monte S.M., Squinto S., Furth M.E., Yancopoulos G.D.Genomics 10:558-568(1991) A rat brain-derived neurotrophic factor-encoding gene generates multiple transcripts through alternative use of 5' exons and polyadenylation sites.Ohara O., Gahara Y., Teraoka H., Kitamura T.Gene 121:383-386(1992) Neurotrophic factors, their receptors, and the signal transduction pathways they activate.Yancopoulos G.D., Maisonpierre P.C., Ip N.Y., Aldrich T.H., Belluscio L., Boulton T.G., Cobb M.H., Squinto S.P., Furth M.E.Cold Spring Harb. Symp. Quant. Biol. 55:371-379(1990) Rodent BDNF genes, novel promoters, novel splice variants, and regulation by cocaine.Liu Q.-R., Lu L., Zhu X.-G., Gong J.-P., Shaham Y., Uhl G.R.Brain Res. 1067:1-12(2006) Mouse and rat BDNF gene structure and expression revisited.Aid T., Kazantseva A., Piirsoo M., Palm K., Timmusk T.J. Neurosci. Res. 85:525-535(2007) Reconstituting BDNF gene to bone marrow mesenchymal stem cells serving as portals in the therapy of Parkinson's disease.Zhao L.X., Zhang J., Wang D.M., Yu X.J., Yue W., Pei X.T., Xu X.H. Multiple promoters direct tissue-specific expression of the rat BDNF gene.Timmusk T., Palm K., Metsis M., Reintam T., Palme V., Saarma M., Persson H.Neuron 10:475-489(1993) Evolutionary studies of the nerve growth factor family reveal a novel member abundantly expressed in Xenopus ovary.Hallboeoek F., Ibanez C.F., Persson H.Neuron 6:845-858(1991)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.3 kDa
NCBI Official Full Name
brain-derived neurotrophic factor isoform 1
NCBI Official Synonym Full Names
brain-derived neurotrophic factor
NCBI Official Symbol
Bdnf
NCBI Protein Information
brain-derived neurotrophic factor
UniProt Protein Name
Brain-derived neurotrophic factor
UniProt Gene Name
Bdnf
UniProt Synonym Gene Names
BDNF
UniProt Entry Name
BDNF_RAT

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Bdnf bdnf (Catalog #AAA116197) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 136-243. Partial. The amino acid sequence is listed below: RRGELSVCDS ISEWVTAADK KTAVDMSGGT VTVLEKVPVS KGQLKQYFYE TKCNPMGYTK EGCRGIDKRH WNSQCRTTQS YVRALTMDSK KRIGWRFIRI DTSCVCTL. It is sometimes possible for the material contained within the vial of "Brain-derived neurotrophic factor (Bdnf), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.