Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA13291_SDS_PAGE.jpg SDS-PAGE

BGP recombinant protein

Recombinant Human Osteocalcin/Bone gla protein (OTB/GP) Protein

Gene Names
BGLAP; OC; BGP; OCN
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
BGP; N/A; Recombinant Human Osteocalcin/Bone gla protein (OTB/GP) Protein; OC; BGLAP; OT; Bone Gla Protein; Bone Gamma-Carboxyglutamate Protein; Gamma-carboxyglutamic acid-containing protein.; BGP recombinant protein
Ordering
For Research Use Only!
Host
E. coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
Lyophilized powder; Lyophilized from 10mM Tris-HCl, 1mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilized is 100uL/ vial
Concentration
0.3 mg/mL (varies by lot)
Sequence Positions
52-94
Sequence
YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYR
Source
Human
Residues
N-terminal GST-tagged.
Usage
We recommedend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1mg/ml. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long term storage at -20°C to -80°C. Our default final concentration of glycerol is 50%.
Preparation and Storage
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
Stability: The recombinant protein is stable for up to 6-12 months from date of receiptat -80°C.

SDS-PAGE

product-image-AAA13291_SDS_PAGE.jpg SDS-PAGE
Related Product Information for BGP recombinant protein
Osteocalcin (OC) is the most abundant noncollagenous protein in mature bone where it constitutes 1% to 2% of the total protein. Synthesized by osteoblasts, it is incorporated into the bone matrix. Osteocalcin is a 49-residue protein with three gamma-carboxyglutamic acid residues, at positions 17, 21 and 24. These three residues confer on it a very strong ability to bind to hydroxyapatite. Osteocalcin is a noncollagenous protein found in bone and dentin. It is secreted by osteoblasts and thought to play a role in mineralization and calcium ion homeostasis. It has been stipulated that osteocalcin may also function as a negative regulator of bone formation, although its exact role is unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
632
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted MW: 32.5 kDa
Observed MW: 32 kDa
NCBI Official Full Name
osteocalcin preproprotein
NCBI Official Synonym Full Names
bone gamma-carboxyglutamate protein
NCBI Official Symbol
BGLAP
NCBI Official Synonym Symbols
OC; BGP; OCN
NCBI Protein Information
osteocalcin
UniProt Protein Name
Osteocalcin
UniProt Gene Name
BGLAP
UniProt Synonym Gene Names
BGP
UniProt Entry Name
OSTCN_HUMAN

Similar Products

Product Notes

The BGP bglap (Catalog #AAA13291) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 52-94. The amino acid sequence is listed below: YLYQWLGAPV PYPDPLEPRR EVCELNPDCD ELADHIGFQE AYR. It is sometimes possible for the material contained within the vial of "BGP, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.