SDS-PAGE
BTB/POZ domain-containing protein 2 Recombinant Protein | BTBD2 recombinant protein
Recombinant human BTB/POZ domain-containing protein 2 protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BTB/POZ domain-containing protein 2; N/A; Recombinant human BTB/POZ domain-containing protein 2 protein; BTBD2 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
MTIEEFAAGPAQSGILVDREVVSLFLHFTVNPKPRVEFIDRPRCCLRGKECSINRFQQVESRWGYSGTSDRIRFSVNKRIFVVGFGLYGSIHGPTDYQVNIQIIHTDSNTVLGQNDTGFSCDGSASTFRVMFKEPVEVLPNVNYTACATLKGPDSHYGTKGLRKVTHESPTTGAKTCFTFCYAAGNNNGTSVEDGQIPEVIFYT
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-PAGE
SDS-PAGE
Related Product Information for BTBD2 recombinant protein
Interacts with topoisomerase 1 and with TRIM5 isoform Delta.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48kD
NCBI Official Full Name
BTB/POZ domain-containing protein 2
NCBI Official Synonym Full Names
BTB (POZ) domain containing 2
NCBI Official Symbol
BTBD2
NCBI Protein Information
BTB/POZ domain-containing protein 2
UniProt Protein Name
BTB/POZ domain-containing protein 2
UniProt Gene Name
BTBD2
UniProt Entry Name
BTBD2_HUMAN
Similar Products
Product Notes
The BTBD2 btbd2 (Catalog #AAA81634) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MTIEEFAAGP AQSGILVDRE VVSLFLHFTV NPKPRVEFID RPRCCLRGKE CSINRFQQVE SRWGYSGTSD RIRFSVNKRI FVVGFGLYGS IHGPTDYQVN IQIIHTDSNT VLGQNDTGFS CDGSASTFRV MFKEPVEVLP NVNYTACATL KGPDSHYGTK GLRKVTHESP TTGAKTCFTF CYAAGNNNGT SVEDGQIPEV IFYT. It is sometimes possible for the material contained within the vial of "BTB/POZ domain-containing protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.