Phospholipase A2 Recombinant Protein | Pla2 recombinant protein
Recombinant Apis mellifera Phospholipase A2
Gene Names
Pla2; bvPLA2; GB13351
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Phospholipase A2; N/A; Recombinant Apis mellifera Phospholipase A2; Pla2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Specificity
This assay has high sensitivity and excellent specificity for detection of human WNT3A. No significant cross-reactivity or interference between human WNT3A and analogues was observed.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
34-167. Full length of the mature protein
Sequence
IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY
Sequence Length
167
Samples
Serum, Plasma
Assay Type
Quantitative Sandwich
Detection Range
0.156 ng/ml-10 ng/ml
Sensitivity
0.039 ng/ml.
Intra-assay Precision
Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess
Inter-assay Precision
Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pla2 recombinant protein
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for WNT3A has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any WNT3A present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for WNT3A is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of WNT3A bound in the initial step. The color development is stopped and the intensity of the color is measured.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.3 kDa
NCBI Official Full Name
phospholipase A2
NCBI Official Symbol
Pla2
NCBI Official Synonym Symbols
bvPLA2; GB13351
NCBI Protein Information
phospholipase A2
UniProt Protein Name
Phospholipase A2
UniProt Gene Name
bvPLA2
UniProt Synonym Gene Names
bvPLA2
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Pla2 bvpla2 (Catalog #AAA114582) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-167. Full length of the mature protein. The amino acid sequence is listed below: IIYPGTLWCG HGNKSSGPNE LGRFKHTDAC CRTHDMCPDV MSAGESKHGL TNTASHTRLS CDCDDKFYDC LKNSADTISS YFVGKMYFNL IDTKCYKLEH PVTGCGERTE GRCLHYTVDK SKPKVYQWFD LRKY. It is sometimes possible for the material contained within the vial of "Phospholipase A2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.