Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18546_SDS_PAGE.png SDS-PAGE

Complement C3 Recombinant Protein | C3 recombinant protein

Recombinant Mouse Complement C3 (C3), partial

Gene Names
C3; ASP; Plp; HSE-MSF; AI255234
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement C3; N/A; Recombinant Mouse Complement C3 (C3), partial; HSE-MSF; C3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1321-1663aa; Partial
Sequence
SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCP
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18546_SDS_PAGE.png SDS-PAGE
Related Product Information for C3 recombinant protein
C3 plays a central role in the activation of the complent system. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity. C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation. Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.
References
Nucleotide sequence of complementary DNA and derived amino acid sequence of murine complement protein C3.Fey G.H., Lundwall A., Wetsel R.A., Tack B.F., de Bruijn M.H.L., Domdey H.Philos. Trans. R. Soc. Lond., B, Biol. Sci. 306:333-344(1984) Structure of murine complement component C3. I. Nucleotide sequence of cloned complementary and genomic DNA coding for the beta chain.Lundwall A., Wetsel R.A., Domdey H., Tack B.F., Fey G.H.J. Biol. Chem. 259:13851-13856(1984) Isolation and analysis of genomic DNA clones encoding the third component of mouse complement.Wiebauer K., Domdey H., Diggelmann H., Fey G.Proc. Natl. Acad. Sci. U.S.A. 79:7077-7081(1982) Common evolutionary origin of alpha 2-macroglobulin and complement components C3 and C4.Sottrup-Jensen L., Stepanik T.M., Kristensen T., Lonblad P.B., Jones C.M., Wierzbicki D.M., Magnusson S., Domdey H., Wetsel R.A., Lundwall A., Tack B.F., Fey G.H.Proc. Natl. Acad. Sci. U.S.A. 82:9-13(1985) Structure and expression of the C3 gene.Fey G., Domdey H., Wiebauer K., Whitehead A.S., Odink K.Springer Semin. Immunopathol. 6:119-147(1983) A paracrine migration-stimulating factor for metastatic tumor cells secreted by mouse hepatic sinusoidal endothelial cells identification as complement component C3b.Hamada J., Cavanaugh P.G., Miki K., Nicolson G.L.Cancer Res. 53:4418-4423(1993) The specific production of the third component of complement by osteoblastic cells treated with 1 alpha,25-dihydroxyvitamin D3.Sato T., Hong M.H., Jin C.H., Ishimi Y., Udagawa N., Shinki T., Abe E., Suda T.FEBS Lett. 285:21-24(1991) Amino acid sequences of mouse complement C3 derived from nucleotide sequences of cloned cDNA.Fey G.H., Wiebauer K., Domdey H.Ann. N. Y. Acad. Sci. 421:307-312(1983) Structure of murine complement component C3. II. Nucleotide sequence of cloned complementary DNA coding for the alpha chain.Wetsel R.A., Lundwall A., Davidson F., Gibson T., Tack B.F., Fey G.H.J. Biol. Chem. 259:13857-13862(1984) Characterization of the mRNA and cloned cDNA specifying the third component of mouse complement.Domdey H., Wiebauer K., Kazmaier M., Mueller V., Odink K., Fey G.H.Proc. Natl. Acad. Sci. U.S.A. 79:7619-7623(1982) The structure of an alternate form of complement C3 that displays costimulatory growth factor activity for B lymphocytes.Cahen-Kramer Y., Martensson I.L., Melchers F.J. Exp. Med. 180:2079-2088(1994) Acylation-stimulating protein (ASP) deficiency induces obesity resistance and increased energy expenditure in ob/ob mice.Xia Z., Sniderman A.D., Cianflone K.J. Biol. Chem. 277:45874-45879(2002) Acylation-stimulating protein deficiency and altered adipose tissue in alternative complement pathway knockout mice.Paglialunga S., Fisette A., Yan Y., Deshaies Y., Brouillette J.F., Pekna M., Cianflone K.Am. J. Physiol. 294:E521-E529(2008)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55.3 kDa
NCBI Official Full Name
complement C3 preproprotein
NCBI Official Synonym Full Names
complement component 3
NCBI Official Symbol
C3
NCBI Official Synonym Symbols
ASP; Plp; HSE-MSF; AI255234
UniProt Protein Name
Complement C3
UniProt Gene Name
C3
UniProt Synonym Gene Names
C3bc; ASP
UniProt Entry Name
CO3_MOUSE

Similar Products

Product Notes

The C3 c3 (Catalog #AAA18546) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1321-1663aa; Partial. The amino acid sequence is listed below: SEETKQNEAF SLTAKGKGRG TLSVVAVYHA KLKSKVTCKK FDLRVSIRPA PETAKKPEEA KNTMFLEICT KYLGDVDATM SILDISMMTG FAPDTKDLEL LASGVDRYIS KYEMNKAFSN KNTLIIYLEK ISHTEEDCLT FKVHQYFNVG LIQPGSVKVY SYYNLEESCT RFYHPEKDDG MLSKLCHSEM CRCAEENCFM QQSQEKINLN VRLDKACEPG VDYVYKTELT NIELLDDFDE YTMTIQQVIK SGSDEVQAGQ QRKFISHIKC RNALKLQKGK KYLMWGLSSD LWGEKPNTSY IIGKDTWVEH WPEAEECQDQ KYQKQCEELG AFTESMVVYG CP . It is sometimes possible for the material contained within the vial of "Complement C3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.