Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Complement C4-B (C4b) Recombinant Protein | C4b recombinant protein

Recombinant Mouse Complement C4-B (C4b)

Gene Names
C4b; C4; Ss
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement C4-B (C4b); N/A; Recombinant Mouse Complement C4-B (C4b); C4b recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1448-1738aa; Partial, Complement C4 gamma chain
Sequence
EAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADITLLSGFHALRADLEKLTSLSDRYVSHFETDGPHVLLYFDSVPTTRECVGFGASQEVVVGLVQPSSAVLYDYYSPDHKCSVFYAAPTKSQLLATLCSGDVCQCAEGKCPRLLRSLERRVEDKDGYRMRFACYYPRVEYGFTVKVLREDGRAAFRLFESKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIMGMDGETSDNKGDPQYLLDSNTWIEEMPSEQMCKSTRHRAACFQLKDFLMEFSSRGCQV
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for C4b recombinant protein
This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
192,915 Da
NCBI Official Full Name
complement C4-B
NCBI Official Synonym Full Names
complement component 4B (Chido blood group)
NCBI Official Symbol
C4b
NCBI Official Synonym Symbols
C4; Ss
NCBI Protein Information
complement C4-B
UniProt Protein Name
Complement C4-B
UniProt Gene Name
C4b
UniProt Synonym Gene Names
C4

Similar Products

Product Notes

The C4b c4b (Catalog #AAA113445) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1448-1738aa; Partial, Complement C4 gamma chain. The amino acid sequence is listed below: EAPKVVEEQE SRVQYTVCIW RNGKLGLSGM AIADITLLSG FHALRADLEK LTSLSDRYVS HFETDGPHVL LYFDSVPTTR ECVGFGASQE VVVGLVQPSS AVLYDYYSPD HKCSVFYAAP TKSQLLATLC SGDVCQCAEG KCPRLLRSLE RRVEDKDGYR MRFACYYPRV EYGFTVKVLR EDGRAAFRLF ESKITQVLHF RKDTMASIGQ TRNFLSRASC RLRLEPNKEY LIMGMDGETS DNKGDPQYLL DSNTWIEEMP SEQMCKSTRH RAACFQLKDF LMEFSSRGCQ V. It is sometimes possible for the material contained within the vial of "Complement C4-B (C4b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.