Complement C5 Recombinant Protein | C5 recombinant protein
Recombinant Human Complement C5 (C5), partial
Gene Names
C5; C5D; C5a; C5b; ECLZB; CPAMD4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement C5; N/A; Recombinant Human Complement C5 (C5), partial; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4; C5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
678-751. Partial
Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for C5 recombinant protein
Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complent components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assbled. Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Product Categories/Family for C5 recombinant protein
References
Complete cDNA sequence of human complement pro-C5. Evidence of truncated transcripts derived from a single copy gene.Haviland D.L., Haviland J.C., Fleischer D.T., Hunt A., Wetsel R.A.J. Immunol. 146:362-368(1991) SeattleSNPs variation discovery resource
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12.3 kDa
NCBI Official Full Name
complement C5 isoform 1 preproprotein
NCBI Official Synonym Full Names
complement component 5
NCBI Official Symbol
C5
NCBI Official Synonym Symbols
C5D; C5a; C5b; ECLZB; CPAMD4
NCBI Protein Information
complement C5
UniProt Protein Name
Complement C5
UniProt Gene Name
C5
UniProt Synonym Gene Names
CPAMD4
UniProt Entry Name
CO5_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The C5 c5 (Catalog #AAA115007) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 678-751. Partial. The amino acid sequence is listed below: TLQKKIEEIA AKYKHSVVKK CCYDGACVNN DETCEQRAAR ISLGPRCIKA FTECCVVASQ LRANISHKDM QLGR. It is sometimes possible for the material contained within the vial of "Complement C5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
