Calreticulin (Calr) Recombinant Protein | Calr recombinant protein
Recombinant Mouse Calreticulin (Calr)
Gene Names
Calr; CRT; Calregulin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calreticulin (Calr); N/A; Recombinant Mouse Calreticulin (Calr); CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP; Calr recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-416aa; Full Length of Mature Protein
Sequence
DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Calr recombinant protein
Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis.
References
Multiple zones in the sequence of calreticulin (CRP55, calregulin, HACBP)
, a major calcium binding ER/SR protein.Smith M.J., Koch G.L.E.EMBO J. 8:3581-3586(1989)
Determination of the sequence of an expressible cDNA clone encoding ERp60/calregulin by the use of a novel nested set method.Mazzarella R.A., Gold P., Cunningham M., Green M.Gene 120:217-225(1992)
Separation and sequencing of familiar and novel murine proteins using preparative two-dimensional gel electrophoresis.Merrick B.A., Patterson R.M., Wichter L.L., He C., Selkirk J.K.Electrophoresis 15:735-745(1994)
Lubec G., Kang S.U., Sunyer B., Chen W.-Q.Submitted (JAN-2009)
to UniProtKB
The calcium-binding protein calreticulin is a major constituent of lytic granules in cytolytic T lymphocytes.Dupuis M., Schaerer E., Krause K.-H., Tschopp J.J. Exp. Med. 177:1-7(1993)
Age-specific CUGBP1-eIF2 complex increases translation of CCAAT/enhancer-binding protein beta in old liver.Timchenko L.T., Salisbury E., Wang G.-L., Nguyen H., Albrecht J.H., Hershey J.W., Timchenko N.A.J. Biol. Chem. 281:32806-32819(2006)
Structural basis of cyclophilin B binding by the calnexin/calreticulin P-domain.Kozlov G., Bastos-Aristizabal S., Maattanen P., Rosenauer A., Zheng F., Killikelly A., Trempe J.F., Thomas D.Y., Gehring K.J. Biol. Chem. 285:35551-35557(2010)
A mouse protein that localizes to acrosome and sperm tail is regulated by Y-chromosome.Bhattacharya R., Devi M.S., Dhople V.M., Jesudasan R.A.BMC Cell Biol. 14:50-50(2013)
SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)
Structural basis of carbohydrate recognition by calreticulin.Kozlov G., Pocanschi C.L., Rosenauer A., Bastos-Aristizabal S., Gorelik A., Williams D.B., Gehring K.J. Biol. Chem. 285:38612-38620(2010)
Structural and functional relationships between the lectin and arm domains of calreticulin.Pocanschi C.L., Kozlov G., Brockmeier U., Brockmeier A., Williams D.B., Gehring K.J. Biol. Chem. 286:27266-27277(2011)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.3 kDa
NCBI Official Full Name
calreticulin
NCBI Official Synonym Full Names
calreticulin
NCBI Official Symbol
Calr
NCBI Official Synonym Symbols
CRT; Calregulin
NCBI Protein Information
calreticulin
UniProt Protein Name
Calreticulin
UniProt Gene Name
Calr
UniProt Synonym Gene Names
ERp60
UniProt Entry Name
CALR_MOUSE
Similar Products
Product Notes
The Calr calr (Catalog #AAA18456) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-416aa; Full Length of Mature Protein. The amino acid sequence is listed below: DPAIYFKEQF LDGDAWTNRW VESKHKSDFG KFVLSSGKFY GDLEKDKGLQ TSQDARFYAL SAKFEPFSNK GQTLVVQFTV KHEQNIDCGG GYVKLFPSGL DQKDMHGDSE YNIMFGPDIC GPGTKKVHVI FNYKGKNVLI NKDIRCKDDE FTHLYTLIVR PDNTYEVKID NSQVESGSLE DDWDFLPPKK IKDPDAAKPE DWDERAKIDD PTDSKPEDWD KPEHIPDPDA KKPEDWDEEM DGEWEPPVIQ NPEYKGEWKP RQIDNPDYKG TWIHPEIDNP EYSPDANIYA YDSFAVLGLD LWQVKSGTIF DNFLITNDEA YAEEFGNETW GVTKAAEKQM KDKQDEEQRL KEEEEDKKRK EEEEAEDKED DDDRDEDEDE EDEKEEDEEE SPGQAKDEL . It is sometimes possible for the material contained within the vial of "Calreticulin (Calr), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
