Cancer,testis antigen 2 (CTAG2) Recombinant Protein | CTAG2 recombinant protein
Recombinant Human Cancer,testis antigen 2 (CTAG2)
Purity
Greater than 85% as determined by SDS-PAGE.
Synonyms
Cancer,testis antigen 2 (CTAG2); N/A; Recombinant Human Cancer,testis antigen 2 (CTAG2); Autoimmunogenic cancer,testis antigen NY-ESO-2 Cancer; testis antigen 6.2; CT6.2 L antigen family member 1; LAGE-1 ESO2; LAGE1; CTAG2 recombinant protein
Host
Yeast
Purity/Purification
Greater than 85% as determined by SDS-PAGE.
Form/Format
Tris-based buffer50% glycerol
Sequence Positions
Full Length, 1-210aa
Sequence
MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Tag Info
N-terminal 6xHis-sumostar-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C,-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C,-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
References
"CD4+ Th2 cell recognition of HLA-DR-restricted epitopes derived from CAMEL: a tumor antigen translated in an alternative open reading frame." Slager E.H., Borghi M., van der Minne C.E., Aarnoudse C.A., Havenga M.J., Schrier P.I., Osanto S., Griffioen M. J. Immunol. 170:1490-1497(2003)
NCBI and Uniprot Product Information
UniProt Accession #
Molecular Weight
37.1 kDa
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CTAG2 (Catalog #AAA310986) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Full Length, 1-210aa. The amino acid sequence is listed below: MQAEGQGTGG STGDADGPGG PGIPDGPGGN AGGPGEAGAT GGRGPRGAGA ARASGPRGGA PRGPHGGAAS AQDGRCPCGA RRPDSRLLQL HITMPFSSPM EAELVRRILS RDAAPLPRPG AVLKDFTVSG NLLFMSVRDQ DREGAGRMRV VGWGLGSASP EGQKARDLRT PKHKVSEQRP GTPGPPPPEG AQGDGCRGVA FNVMFSAPHI. It is sometimes possible for the material contained within the vial of "Cancer,testis antigen 2 (CTAG2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.