Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279259_BIOACTIVITY11.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10ug/mL can bind Anti-CCR9 recombinant antibody , the EC50 is 31.67-36.83 ng/mL.The VLPs is negative control.)

C-C chemokine receptor type 9 (CCR9) Recombinant Protein | CCR9 recombinant protein

Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

Gene Names
CCR9; GPR28; CDw199; GPR-9-6; CC-CKR-9
Purity
The purity of CCR9 was greater than 95% as determined by SEC-HPLC.
Synonyms
C-C chemokine receptor type 9 (CCR9); N/A; Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active); C-C CKR-9; CC-CKR-9; CCR-9; G-protein coupled receptor 28; GPR-9-6; CCR9 recombinant protein
Ordering
Host
Mammalian cell
Purity/Purification
The purity of CCR9 was greater than 95% as determined by SEC-HPLC.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
1-369aa; Full Length
Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Research Area
ImmunologyLess than 1.0 EU/ug as determined by LAL method.
Transmembrane Domain
7TM
Biological_Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 ug/mL can bind Anti-CCR9 recombinant antibody. The EC50 is 31.67-36.83 ng/mL.The VLPs is negative control.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80 degree C.Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
The VLPs are expressed from human 293 cells (HEK293). Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended. Store the protein at -20 degree C/-80 degree C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10ug/mL can bind Anti-CCR9 recombinant antibody , the EC50 is 31.67-36.83 ng/mL.The VLPs is negative control.)

product-image-AAA279259_BIOACTIVITY11.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10ug/mL can bind Anti-CCR9 recombinant antibody , the EC50 is 31.67-36.83 ng/mL.The VLPs is negative control.)

Application Data

(The purity of VLPs was greater than 95% as determined by HPLC-SEC.)

product-image-AAA279259_AD13.jpg Application Data (The purity of VLPs was greater than 95% as determined by HPLC-SEC.)

Application Data

(is detected by Mouse anti-6*His monoclonal antibody.)

product-image-AAA279259_AD15.jpg Application Data (is detected by Mouse anti-6*His monoclonal antibody.)
Related Product Information for CCR9 recombinant protein
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.
Product Categories/Family for CCR9 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
40,713 Da
NCBI Official Full Name
C-C chemokine receptor type 9
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 9
NCBI Official Symbol
CCR9
NCBI Official Synonym Symbols
GPR28; CDw199; GPR-9-6; CC-CKR-9
NCBI Protein Information
C-C chemokine receptor type 9; G protein-coupled receptor 28
UniProt Protein Name
C-C chemokine receptor type 9
UniProt Gene Name
CCR9
UniProt Synonym Gene Names
GPR28; C-C CKR-9; CC-CKR-9; CCR-9
UniProt Entry Name
CCR9_HUMAN

Similar Products

Product Notes

The CCR9 ccr9 (Catalog #AAA279259) is a Recombinant Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-369aa; Full Length. The amino acid sequence is listed below: MTPTDFTSPI PNMADDYGSE STSSMEDYVN FNFTDFYCEK NNVRQFASHF LPPLYWLVFI VGALGNSLVI LVYWYCTRVK TMTDMFLLNL AIADLLFLVT LPFWAIAAAD QWKFQTFMCK VVNSMYKMNF YSCVLLIMCI SVDRYIAIAQ AMRAHTWREK RLLYSKMVCF TIWVLAAALC IPEILYSQIK EESGIAICTM VYPSDESTKL KSAVLTLKVI LGFFLPFVVM ACCYTIIIHT LIQAKKSSKH KALKVTITVL TVFVLSQFPY NCILLVQTID AYAMFISNCA VSTNIDICFQ VTQTIAFFHS CLNPVLYVFV GERFRRDLVK TLKNLGCISQ AQWVSFTRRE GSLKLSSMLL ETTSGALSL. It is sometimes possible for the material contained within the vial of "C-C chemokine receptor type 9 (CCR9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.