Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Scavenger receptor cysteine-rich type 1 protein M160 (CD163L1) Recombinant Protein | CD163L1 recombinant protein

Recombinant Human Scavenger receptor cysteine-rich type 1 protein M160 (CD163L1) , partial

Average rating 0.0
No ratings yet
Gene Names
CD163L1; WC1; M160; CD163B; SCARI2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Scavenger receptor cysteine-rich type 1 protein M160 (CD163L1); N/A; Recombinant Human Scavenger receptor cysteine-rich type 1 protein M160 (CD163L1) , partial; CD163L1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
48-469aa; Partial
Sequence
LRLVNGDGPCSGTVEVKFQGQWGTVCDDGWNTTASTVVCKQLGCPFSFAMFRFGQAVTRHGKIWLDDVSCYGNESALWECQHREWGSHNCYHGEDVGVNCYGEANLGLRLVDGNNSCSGRVEVKFQERWGTICDDGWNLNTAAVVCRQLGCPSSFISSGVVNSPAVLRPIWLDDILCQGNELALWNCRHRGWGNHDCSHNEDVTLTCYDSSDLELRLVGGTNRCMGRVELKIQGRWGTVCHHKWNNAAADVVCKQLGCGTALHFAGLPHLQSGSDVVWLDGVSCSGNESFLWDCRHSGTVNFDCLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICS
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CD163L1 recombinant protein
This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. The SRCR family is defined by a 100-110 amino acid SRCR domain, which may mediate protein-protein interaction and ligand binding. The encoded protein contains twelve SRCR domains, a transmembrane region and a cytoplasmic domain. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
160,322 Da
NCBI Official Full Name
scavenger receptor cysteine-rich type 1 protein M160 isoform 1
NCBI Official Synonym Full Names
CD163 molecule like 1
NCBI Official Symbol
CD163L1
NCBI Official Synonym Symbols
WC1; M160; CD163B; SCARI2
NCBI Protein Information
scavenger receptor cysteine-rich type 1 protein M160
UniProt Protein Name
Scavenger receptor cysteine-rich type 1 protein M160
UniProt Gene Name
CD163L1
UniProt Synonym Gene Names
CD163B; M160

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD163L1 cd163l1 (Catalog #AAA117498) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 48-469aa; Partial. The amino acid sequence is listed below: LRLVNGDGPC SGTVEVKFQG QWGTVCDDGW NTTASTVVCK QLGCPFSFAM FRFGQAVTRH GKIWLDDVSC YGNESALWEC QHREWGSHNC YHGEDVGVNC YGEANLGLRL VDGNNSCSGR VEVKFQERWG TICDDGWNLN TAAVVCRQLG CPSSFISSGV VNSPAVLRPI WLDDILCQGN ELALWNCRHR GWGNHDCSHN EDVTLTCYDS SDLELRLVGG TNRCMGRVEL KIQGRWGTVC HHKWNNAAAD VVCKQLGCGT ALHFAGLPHL QSGSDVVWLD GVSCSGNESF LWDCRHSGTV NFDCLHQNDV SVICSDGADL ELRLADGSNN CSGRVEVRIH EQWWTICDQN WKNEQALVVC KQLGCPFSVF GSRRAKPSNE ARDIWINSIS CTGNESALWD CTYDGKAKRT CFRRSDAGVI CS. It is sometimes possible for the material contained within the vial of "Scavenger receptor cysteine-rich type 1 protein M160 (CD163L1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.