Carcinoembryonic antigen-related cell adhesion molecule 5 Recombinant Protein | CEACAM5 recombinant protein

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5

Cat. Num. AAA113225

• Gene Names: CEACAM5; CEA; CD66e
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Carcinoembryonic antigen-related cell adhesion molecule 5; N/A; Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 5; Carcinoembryonic antigen; CEA; Meconium antigen 100; CD66e; CEACAM5 recombinant protein

• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 35-685; Mature full length protein
• Sequence: KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA
• Sequence Length: 685

• Product Note: Applications are user defined. Product is developed and quality control tested in house, data or additional information may be provided upon request. The researcher needs to establish and confirm the suitability of the product for their application.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CEACAM5 recombinant protein

Cell surface glycoprotein that plays a role in cell adhesion and in intracellular signaling. Receptor for E Coli Dr adhesins.

Product Categories/Family for CEACAM5 recombinant protein

Tags & Cell Markers; Raw Materials Assay Development

References

Isolation and characterization of full-length functional cDNA clones for human carcinoembryonic antigen.Beauchemin N., Benchimol S., Cournoyer D., Fuks A., Stanners C.P.Mol. Cell. Biol. 7:3221-3230(1987) Carcinoembryonic antigen family characterization of cDNAs coding for NCA and CEA and suggestion of nonrandom sequence variation in their conserved loop-domains.Barnett T., Goebel S.J., Nothdurft M.A., Elting J.J.Genomics 3:59-66(1988) Cloning of the complete gene for carcinoembryonic antigen analysis of its promoter indicates a region conveying cell type-specific expression.Schrewe H., Thompson J., Bona M., Hefta L.J.F., Maruya A., Hassauer M., Shively J.E., von Kleist S., Zimmermann W.Mol. Cell. Biol. 10:2738-2748(1990) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004) Primary structure of human carcinoembryonic antigen (CEA) deduced from cDNA sequence.Oikawa S., Nakazato H., Kosaki G.Biochem. Biophys. Res. Commun. 142:511-518(1987) Isolation and characterization of cDNA clones encoding the human carcinoembryonic antigen reveal a highly conserved repeating structure.Zimmermann W., Ortlieb B., Friedrich R., von Kleist S.Proc. Natl. Acad. Sci. U.S.A. 84:2960-2964(1987) Self recognition in the Ig superfamily. Identification of precise subdomains in carcinoembryonic antigen required for intercellular adhesion.Taheri M., Saragovi U., Fuks A., Makkerh J., Mort J., Stanners C.P.J. Biol. Chem. 275:26935-26943(2000) Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.Ramachandran P., Boontheung P., Xie Y., Sondej M., Wong D.T., Loo J.A.J. Proteome Res. 5:1493-1503(2006) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Structural models for carcinoembryonic antigen and its complex with the single-chain Fv antibody molecule MFE23.Boehm M.K., Perkins S.J.FEBS Lett. 475:11-16(2000) Binding of Dr adhesins of Escherichia coli to carcinoembryonic antigen triggers receptor dissociation.Korotkova N., Yang Y., Le Trong I., Cota E., Demeler B., Marchant J., Thomas W.E., Stenkamp R.E., Moseley S.L., Matthews S.Mol. Microbiol. 67:420-434(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 612407802
• NCBI GeneID: 1048
• NCBI Accession #: NP_001278413.1
• NCBI GenBank Nucleotide #: NM_001291484.2
• UniProt Accession #: P06731; H9KVA7
• Molecular Weight: 73.33kD
• NCBI Official Full Name: carcinoembryonic antigen-related cell adhesion molecule 5 isoform 1 preproprotein
• NCBI Official Synonym Full Names: carcinoembryonic antigen related cell adhesion molecule 5
• NCBI Official Symbol: CEACAM5
• NCBI Official Synonym Symbols: CEA; CD66e
• NCBI Protein Information: carcinoembryonic antigen-related cell adhesion molecule 5
• UniProt Protein Name: Carcinoembryonic antigen-related cell adhesion molecule 5
• UniProt Gene Name: CEACAM5
• UniProt Synonym Gene Names: CEA; CEA
• UniProt Entry Name: CEAM5_HUMAN