Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113617_SDS_PAGE15.jpg SDS-PAGE

Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) Recombinant Protein | CEACAM6 recombinant protein

Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6)

Average rating 0.0
No ratings yet
Gene Names
CEACAM6; NCA; CEAL; CD66c
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6); N/A; Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6); Carcinoembryonic antigen-related cell adhesion molecule 6; Non-specific crossreacting antigen; Normal cross-reacting antigen; CD_antigen=; CD66c; CEACAM6 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-320aa; Full Length of Mature Protein
Sequence
KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

product-image-AAA113617_SDS_PAGE15.jpg SDS-PAGE
Product Categories/Family for CEACAM6 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.2 kDa
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 6 preproprotein
NCBI Official Synonym Full Names
carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
NCBI Official Symbol
CEACAM6
NCBI Official Synonym Symbols
NCA; CEAL; CD66c
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 6; normal cross-reacting antigen; Cluster of Differentiation 66c
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 6
UniProt Gene Name
CEACAM6
UniProt Synonym Gene Names
NCA
UniProt Entry Name
CEAM6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CEACAM6 ceacam6 (Catalog #AAA113617) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-320aa; Full Length of Mature Protein. The amino acid sequence is listed below: KLTIESTPFN VAEGKEVLLL AHNLPQNRIG YSWYKGERVD GNSLIVGYVI GTQQATPGPA YSGRETIYPN ASLLIQNVTQ NDTGFYTLQV IKSDLVNEEA TGQFHVYPEL PKPSISSNNS NPVEDKDAVA FTCEPEVQNT TYLWWVNGQS LPVSPRLQLS NGNMTLTLLS VKRNDAGSYE CEIQNPASAN RSDPVTLNVL YGPDGPTISP SKANYRPGEN LNLSCHAASN PPAQYSWFIN GTFQQSTQEL FIPNITVNNS GSYMCQAHNS ATGLNRTTVT MITVSG. It is sometimes possible for the material contained within the vial of "Carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.