Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Sequence
hLangerin (accession number NM_015717):
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP
Sequence Length
328
Applicable Applications for CD207 cell line
FA (Functional Assay)
Content
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO
Dry Ice Note
The product may be shipped with dry ice, and an additional fee may be added to your shipping cost.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.
Shipping: Dry Ice.
Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.
Shipping: Dry Ice.
Dry Ice Shipment: Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Shipping Note: Product is available for shipment in the United States, Canada and European countries. Please inquire for shipment to other countries.
Related Product Information for CD207 cell line
Langerin Stable Cell Line is a stably transfected CHO-K1 cell line which expresses human Langerin, also known as CD207.
Product Categories/Family for CD207 cell line
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,725 Da
NCBI Official Full Name
langerin
NCBI Official Synonym Full Names
CD207 molecule
NCBI Official Symbol
CD207
NCBI Official Synonym Symbols
CLEC4K
NCBI Protein Information
C-type lectin domain family 4 member K
UniProt Protein Name
C-type lectin domain family 4 member K
UniProt Gene Name
CD207
UniProt Synonym Gene Names
CLEC4K
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CD207 cd207 (Catalog #AAA78448) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Langerin can be used in a range of immunoassay formats including, but not limited to, FA (Functional Assay). Researchers should empirically determine the suitability of the CD207 cd207 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: hLangerin (accession number NM_015717) : MTVEK EAPDAHFTVD KQNISLWPRE PPPKSGPSLV PGKTPTVRAA LICLTLVLVA SVLLQAVLYP RFMGTISDVK TNVQLLKGRV DNISTLDSEI KKNSDGMEAA GVQIQMVNES LGYVRSQFLK LKTSVEKANA QIQILTRSWE EVSTLNAQIP ELKSDLEKAS ALNTKIRALQ GSLENMSKLL KRQNDILQVV SQGWKYFKGN FYYFSLIPKT WYSAEQFCVS RNSHLTSVTS ESEQEFLYKT AGGLIYWIGL TKAGMEGDWS WVDDTPFNKV QSVRFWIPGE PNNAGNNEHC GNIKAPSLQA WNDAPCDKTF LFICKRPYVP SEP. It is sometimes possible for the material contained within the vial of "Langerin, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
