Carboxylesterase 1C Recombinant Protein | Ces1c recombinant protein
Recombinant Mouse Carboxylesterase 1C (Ces1c), partial
Gene Names
Ces1c; Ee1; Es1; Es4; EsN; Ee-1; Es-4; Es-N; PESN; Ces-N
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carboxylesterase 1C; N/A; Recombinant Mouse Carboxylesterase 1C (Ces1c), partial; Liver carboxylesterase N; Lung surfactant convertase; PES-N; Ces1c recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-550aa; Partial
Sequence
HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Ces1c recombinant protein
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
References
Characterization of a murine cDNA encoding a member of the carboxylesterase multigene family.Ovnic M., Tepperman K., Medda S., Elliott R.W., Stephenson D.A., Grant S.G., Ganschow R.E.Genomics 9:344-354(1991)
Molecular cloning, characterization, and differential expression pattern of mouse lung surfactant convertase.Krishnasamy S., Teng A.L., Dhand R., Schultz R.M., Gross N.J.Am. J. Physiol. 275:L969-L975(1998)
Lineage-specific biology revealed by a finished genome assembly of the mouse.Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009)
cDNA cloning of esterase 1, the major esterase activity in mouse plasma.Genetta T.L., D'Eustachio P., Kadner S.S., Finlay T.H.Biochem. Biophys. Res. Commun. 151:1364-1370(1988)
Proteome-wide characterization of N-glycosylation events by diagonal chromatography.Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K.J. Proteome Res. 5:2438-2447(2006)
Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides.Bernhard O.K., Kapp E.A., Simpson R.J.J. Proteome Res. 6:987-995(2007)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
60.6 kDa
NCBI Official Full Name
carboxylesterase 1C
NCBI Official Synonym Full Names
carboxylesterase 1C
NCBI Official Symbol
Ces1c
NCBI Official Synonym Symbols
Ee1; Es1; Es4; EsN; Ee-1; Es-4; Es-N; PESN; Ces-N
NCBI Protein Information
carboxylesterase 1C
UniProt Protein Name
Carboxylesterase 1C
UniProt Gene Name
Ces1c
UniProt Synonym Gene Names
Es1
UniProt Entry Name
EST1C_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Ces1c ces1c (Catalog #AAA18600) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-550aa; Partial. The amino acid sequence is listed below: HSLLPPVVDT TQGKVLGKYI SLEGFEQPVA VFLGVPFAKP PLGSLRFAPP QPAEPWSFVK NATSYPPMCS QDAGWAKILS DMFSTEKEIL PLKISEDCLY LNIYSPADLT KSSQLPVMVW IHGGGLVIGG ASPYNGLALS AHENVVVVTI QYRLGIWGLF STGDEHSPGN WAHLDQLAAL RWVQDNIANF GGNPDSVTIF GESSGGISVS VLVLSPLGKD LFHRAISESG VVINTNVGKK NIQAVNEIIA TLSQCNDTSS AAMVQCLRQK TESELLEISG KLVQYNISLS TMIDGVVLPK APEEILAEKS FNTVPYIVGF NKQEFGWIIP MMLQNLLPEG KMNEETASLL LRRFHSELNI SESMIPAVIE QYLRGVDDPA KKSELILDMF GDIFFGIPAV LLSRSLRDAG VSTYMYEFRY RPSFVSDKRP QTVEGDHGDE IFFVFGAPLL KEGASEEETN LSKMVMKFWA NFARNGNPNG EGLPHWPEYD EQEGYLQIGA TTQQAQRLKA EEVAFWTELL AKNPPETDPT EH . It is sometimes possible for the material contained within the vial of "Carboxylesterase 1C, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
