SDS-PAGE
Cofilin-1 (CFL1) Recombinant Protein | CFL1 recombinant protein
Recombinant Human Cofilin-1 (CFL1) Protein
Gene Names
CFL1; CFL; cofilin; HEL-S-15
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Cofilin-1 (CFL1); N/A; Recombinant Human Cofilin-1 (CFL1) Protein; CFL1; CFL; HEL-S-15; CFL1 recombinant protein
Host
E. coli AA 1-166 (P23528).
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 7.4, 15% glycerol.
Concentration
1 mg/mL (varies by lot)
Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGK
PL
Sequence Length
166
Species
Human
Source
Human
Protein residue
with N-terminal 6*His Tagged.
Usage
CFL1 Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.
SDS-PAGE
SDS-PAGE
Related Product Information for CFL1 recombinant protein
Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus. CFL1 is a part of the ADF/cofilin family. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus. One group reports that reelin signaling leads to serine3-phosphorylation of cofilin-1, and this interaction may play a role in the reelin-related regulation of neuronal migration.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 25 kDa
Observed MW: 25 kDa
Observed MW: 25 kDa
NCBI Official Full Name
cofilin-1
NCBI Official Synonym Full Names
cofilin 1
NCBI Official Symbol
CFL1
NCBI Official Synonym Symbols
CFL; cofilin; HEL-S-15
NCBI Protein Information
cofilin-1
UniProt Protein Name
Cofilin-1
UniProt Gene Name
CFL1
UniProt Synonym Gene Names
CFL; p18
Similar Products
Product Notes
The CFL1 cfl1 (Catalog #AAA55981) is a Recombinant Protein produced from E. coli AA 1-166 (P23528). and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MASGVAVSDG VIKVFNDMKV RKSSTPEEVK KRKKAVLFCL SEDKKNIILE EGKEILVGDV GQTVDDPYAT FVKMLPDKDC RYALYDATYE TKESKKEDLV FIFWAPESAP LKSKMIYASS KDAIKKKLTG IKHELQANCY EEVKDRCTLA EKLGGSAVIS LEGK PL. It is sometimes possible for the material contained within the vial of "Cofilin-1 (CFL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.