Acetylcholine receptor subunit gamma Recombinant Protein | CHRNG recombinant protein
Recombinant Human Acetylcholine receptor subunit gamma
Gene Names
CHRNG; ACHRG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acetylcholine receptor subunit gamma; N/A; Recombinant Human Acetylcholine receptor subunit gamma; Homo sapiens (Human); CHRNG recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-240aa; partial
Sequence
RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for CHRNG recombinant protein
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Product Categories/Family for CHRNG recombinant protein
References
"Cloning and sequence analysis of human genomic DNA encoding gamma subunit precursor of muscle acetylcholine receptor." Shibahara S., Kubo T., Perski H.J., Takahashi H., Noda M., Numa S. Eur. J. Biochem. 146:15-22(1985)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27.5 kDa
NCBI Official Full Name
acetylcholine receptor subunit gamma
NCBI Official Synonym Full Names
cholinergic receptor nicotinic gamma subunit
NCBI Official Symbol
CHRNG
NCBI Official Synonym Symbols
ACHRG
NCBI Protein Information
acetylcholine receptor subunit gamma
UniProt Protein Name
Acetylcholine receptor subunit gamma
UniProt Gene Name
CHRNG
UniProt Synonym Gene Names
ACHRG
UniProt Entry Name
ACHG_HUMAN
Similar Products
Product Notes
The CHRNG chrng (Catalog #AAA113662) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-240aa; partial. The amino acid sequence is listed below: RNQEERLLAD LMQNYDPNLR PAERDSDVVN VSLKLTLTNL ISLNEREEAL TTNVWIEMQW CDYRLRWDPR DYEGLWVLRV PSTMVWRPDI VLENNVDGVF EVALYCNVLV SPDGCIYWLP PAIFRSACSI SVTYFPFDWQ NCSLIFQSQT YSTNEIDLQL SQEDGQTIEW IFIDPEAFTE NGEWAIQHRP AKMLLDPAAP AQEAGHQKVV FYLLIQRK. It is sometimes possible for the material contained within the vial of "Acetylcholine receptor subunit gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
