Creatine kinase U-type Recombinant Protein | CKMT1B recombinant protein
Recombinant Human Creatine kinase U-type, mitochondrial
Gene Names
CKMT1A; CKMT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Creatine kinase U-type; N/A; Recombinant Human Creatine kinase U-type, mitochondrial; Acidic-type mitochondrial creatine kinase; Mia-CK; Ubiquitous mitochondrial creatine kinase; U-MtCK; CKMT1B recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
40-417aa; Full Length
Sequence
ASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Sequence Length
417
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for CKMT1B recombinant protein
Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e. g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy dands, such as skeletal muscle, heart, brain and spermatozoa.
Product Categories/Family for CKMT1B recombinant protein
References
Isolation and characterization of the gene and cDNA encoding human mitochondrial creatine kinase.Haas R.C., Korenfeld C., Zhang Z., Perryman B., Roman D., Strauss A.W.J. Biol. Chem. 264:2890-2897(1989)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47.1 kDa
NCBI Official Full Name
creatine kinase U-type, mitochondrial
NCBI Official Synonym Full Names
creatine kinase, mitochondrial 1A
NCBI Official Symbol
CKMT1A
NCBI Official Synonym Symbols
CKMT1
NCBI Protein Information
creatine kinase U-type, mitochondrial
UniProt Protein Name
Creatine kinase U-type, mitochondrial
UniProt Gene Name
CKMT1A
UniProt Synonym Gene Names
CKMT; Mia-CK; U-MtCK
UniProt Entry Name
KCRU_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CKMT1B ckmt1a (Catalog #AAA113924) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 40-417aa; Full Length. The amino acid sequence is listed below: ASERRRLYPP SAEYPDLRKH NNCMASHLTP AVYARLCDKT TPTGWTLDQC IQTGVDNPGH PFIKTVGMVA GDEETYEVFA DLFDPVIQER HNGYDPRTMK HTTDLDASKI RSGYFDERYV LSSRVRTGRS IRGLSLPPAC TRAERREVER VVVDALSGLK GDLAGRYYRL SEMTEAEQQQ LIDDHFLFDK PVSPLLTAAG MARDWPDARG IWHNNEKSFL IWVNEEDHTR VISMEKGGNM KRVFERFCRG LKEVERLIQE RGWEFMWNER LGYILTCPSN LGTGLRAGVH IKLPLLSKDS RFPKILENLR LQKRGTGGVD TAATGGVFDI SNLDRLGKSE VELVQLVIDG VNYLIDCERR LERGQDIRIP TPVIHTKH. It is sometimes possible for the material contained within the vial of "Creatine kinase U-type, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
