Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Calcium-activated chloride channel regulator 1 (CLCA1), partial Recombinant Protein | CLCA1 recombinant protein

Recombinant Pig Calcium-activated chloride channel regulator 1 (CLCA1), partial

Gene Names
CLCA1; AECC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium-activated chloride channel regulator 1 (CLCA1), partial; N/A; Recombinant Pig Calcium-activated chloride channel regulator 1 (CLCA1), partial; Calcium-activated chloride channel regulator 1; Calcium-activated chloride channel family member 1; pCLCA1; CLCA1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
46-199. Partial.
Sequence
DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ
Sequence Length
199
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CLCA1 recombinant protein
This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22.8 kDa
NCBI Official Full Name
calcium-activated chloride channel regulator 1
NCBI Official Symbol
CLCA1
NCBI Official Synonym Symbols
AECC
NCBI Protein Information
calcium-activated chloride channel regulator 1; epithelial chloride channel protein; calcium-activated chloride channel family member 1
UniProt Protein Name
Calcium-activated chloride channel regulator 1
UniProt Gene Name
CLCA1
UniProt Synonym Gene Names
AECC
UniProt Entry Name
CLCA1_PIG

Similar Products

Product Notes

The CLCA1 clca1 (Catalog #AAA117177) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 46-199. Partial. The amino acid sequence is listed below: DERLIQNIKD MVTKASPYLF EATEKRFYFK NVAILIPASW KAKPEYVKPK LETYKNADVV VTEPNPPEND GPYTEQMGNC GEKGEKIYFT PDFVAGKKVL QYGPQGRVFV HEWAHLRWGV FNEYNNEQKF YLSNKKEQPV ICSAAIRGTN VLPQ. It is sometimes possible for the material contained within the vial of "Calcium-activated chloride channel regulator 1 (CLCA1), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.